KEGG   Capsella rubella: 17892939Help
Entry
17892939          CDS       T02984                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase SDP6, mitochondrial
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
crb  Capsella rubella
Pathway
crb00564  Glycerophospholipid metabolism
crb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    17892939
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     17892939
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 FAD_binding_3 GIDA Pyr_redox HI0933_like AAA_30 3HCDH_N NAD_binding_8
Motif
Other DBs
NCBI-GeneID: 17892939
NCBI-ProteinID: XP_006299836
UniProt: R0HSE1
LinkDB All DBs
Position
Unknown
AA seq 629 aa AA seqDB search
MSVASIRRLAAGAAVIAAASGGAVFLSPSVVSSDRGGGPVLDSLRRRIGDPTASIPPRSA
QESALIGATASNPLDVLVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLVFHALEERKQLIENAPHLCHALPCMTPCFDWFEVIYFWMG
LKMYDLVAGPRLLHLSRYYSAQESVELFPTLARKGKDKNLRGTVVYYDGQMNDSRLNVGL
ACTAALAGAAVLNHAEVVSLITDDATKRIIGAQVRNNLTGQEFDSYAKVVVNAAGPFCDS
IRKMVDEDTKPMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTD
SNTSITALPEPHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESISR
DHVVFEECPGLVTITGGKWTTYRSMAEDAVNAAIKSGKLSPTNECVTQKLQLLGSYGWEP
SSFTTLAQQYVRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGKRLAH
GHPFLEAEVAYCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKTR
QKQELQKAKEFLQTFKSSKNAQFNDGKHN
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgcttctattcgccgtttagctgccggagcagccgtaattgctgctgcatcc
ggtggcgctgtcttcctgtctccgtcggttgtctccagcgacagaggcggtggtcccgtt
ctagattcactgaggcgtaggattggtgatcccaccgcttctataccgcctcgatctgct
caagagtctgctttaattggagccaccgcttctaatccgctcgatgttctcgtcattggc
ggtggagccaccggttctggtgtcgctctcgacgctgctacacgtggcctccgtgttggt
ttggtggagcgagaggatttctcctccgggacttcttcgcgatcaactaagctgattcat
ggaggggttcgttacttggagaaagctgttttcaatcttgattatggacagctgaagcta
gtatttcacgctcttgaagagcgtaagcagctcattgagaatgcaccacatctctgccat
gctctgccctgtatgacaccttgttttgactggttcgaagttatctacttctggatgggg
ttgaaaatgtatgacttggtcgcaggaccacgcttattgcatctctccagatattattct
gcgcaagagtctgttgagctcttccccactcttgcaaggaaagggaaagacaagaattta
aggggaactgttgtttattatgacgggcaaatgaatgattcacgtctgaatgtgggtttg
gcatgtactgctgcgttagctggtgctgcagttctcaaccatgccgaggttgtgtcactt
attacagatgatgctactaagagaataattggtgcccaagttcgtaacaatctcacaggc
caagaatttgacagctatgcaaaagtagttgttaatgcggctggaccgttctgtgattcc
attaggaagatggttgatgaagatacaaaaccaatgatatgtccaagcagcggtgtacac
attgttctgcctgattactattctccagaagggatgggcttgatagtccctaaaaccaag
gatggtcgtgttgtatttatgttaccgtggttgggaagaacagtagcaggcaccacagac
tctaacacatcaatcactgcacttccagaacctcatgaagatgagattcaatttattctg
gatgcaatcagcgactatcttaacattaaggttcgacgtactgatgttctttcggcttgg
agtggtatccgtccattggccatggatccaacagccaagagcacagagagcatctctaga
gaccacgttgtcttcgaggaatgtcctggtctggttacaatcacgggtggaaaatggaca
acttatcgaagcatggcggaagatgcagttaatgcagcaatcaaatcgggaaaactaagt
ccaaccaatgaatgtgtaacgcagaaactacagcttctgggttcttatggatgggaacca
tcttccttcacaactcttgcacagcaatacgtgcgcatgaagaaaacttacggtggtaaa
gtggttcctggagcaatggacacagctgctgcaaagcatttgtctcatgcctatggttca
atggctgaccgagtcgccaccatagctcaggaggagggtttggggaaacggttggcgcat
gggcatccgtttttggaagcagaggttgcttactgtgcaaggcacgagtactgcgaatca
gcggttgatttcatagcaaggagatgtagaatagcgttcttggacacagacgcagcggcg
cgggcgttacagcgtgttgtggagattctagccagtgaacacaagtgggacaagacgagg
cagaagcaggaattgcaaaaggcaaaagagtttcttcaaacattcaagtcttccaaaaac
gcacagtttaacgatggcaaacacaactaa

DBGET integrated database retrieval system