KEGG   Capsella rubella: 17893851Help
Entry
17893851          CDS       T02984                                 

Definition
(RefSeq) phosphoenolpyruvate carboxylase 3
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
crb  Capsella rubella
Pathway
crb00620  Pyruvate metabolism
crb00710  Carbon fixation in photosynthetic organisms
crb01100  Metabolic pathways
crb01200  Carbon metabolism
Module
crb_M00168  CAM (Crassulacean acid metabolism), dark
crb_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
crb_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
crb_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    17893851
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    17893851
Enzymes [BR:crb01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     17893851
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 17893851
NCBI-ProteinID: XP_006296907
UniProt: R0HWI9
LinkDB All DBs
Position
Unknown
AA seq 968 aa AA seqDB search
MAGRNVEKMASIDAQLRQLVPAKVSEDDKLIEYDALLLDRFLDILQDLHGEDLRETVQEL
YELSAEYEGKREPKKLEELGSVLTSLDPGDSIVISKAFSHMLNLANLAEEVQIAHRRRIK
KLKKGDFVDESSATTESDIEETFKRLVSDLGKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDESLQREIQAAFRTDEIRRTPPTPQDEMRAG
MSYFHETIWNGVPKFLRRVDTALKNIGIDERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAANLYYNQIENLMFELSMWRCTDEFRARADELHRNSRKDAAKHYIEFWKT
IPPTEPYRVILGDVRDKLYHTRERSRQLLSNGISDIPEEATFTNVEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRVDIRQESERHTDVLDAITKHLGIGSSYRDWSE
EGRQEWLLAELSGKRPLFGPDLPKTEEIADVLDTFKVISELPSDCFGAYIISMATSPSDV
LAVELLQRECHVKKPLRVVPLFEKLADLEAAPAAVARLFSIDWYKNRINGKQEVMIGYSD
SGKDAGRLSAAWELYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDT
VNGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMNPPISPKPEWRALLDEMAVV
ATEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQ
TRFHLPVWLGFGAAFRFAIKKDVRNLHMLQDMYKNWPFFRVTIDLIEMVFAKGDPGIAAL
YDKLLVSEDLWAFGEKLRANFEETKNLVLQTAGHRDLLEGDPYLKQRLRLRDSYITTLNV
CQAYTLKRIRDPNYNVTLRPHISKEIMQSSKSAQELVKLNPTSEYAPGLEDTLILTMKGI
AAGLQNTG
NT seq 2907 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtcggaacgtagagaagatggcatcgattgatgctcagcttcggcaacttgtt
cctgctaaagtcagtgaagacgataagcttattgagtatgatgctcttctcctcgatcgt
tttctcgacattctccaggatttacacggcgaggatctccgtgaaacggttcaagagcta
tacgagctttctgctgagtatgaagggaagcgtgaacctaagaagcttgaggaactaggg
agtgttctaacgagtttggatcctggtgactccattgttatctccaaggctttctctcac
atgcttaacttagccaacttggctgaagaggtgcagattgctcaccgccgcaggatcaag
aagctcaagaagggtgatttcgttgatgagagctctgcaactactgaatccgatatcgaa
gagacgttcaagagactcgtttctgatcttggcaagtctcctgaagagatatttgatgcc
ctgaagaatcagactgtggatttggttttgactgctcatcctactcagtctgtgcgtaga
tcattgcttcaaaagcatgggaggataagagactgtcttgcccaactgtatgcaaaggac
attactcctgatgacaagcaggagctcgatgagtctctgcaaagagagattcaagctgca
ttccgtaccgatgagattagaagaacacctccaaccccacaagatgaaatgagagctgga
atgagttatttccacgagacaatttggaatggtgtccccaagttcttgcgtcgtgtggat
acagctctgaaaaacattgggattgatgaacgtgtcccttacaatgccccattgatccaa
ttctcttcatggatgggcggtgatcgtgatggtaatccgagggttacacctgaggtcacc
agagatgtgtgcctgttggctagaatgatggctgcaaatctctattataaccaaatcgag
aacctgatgtttgagttgtctatgtggcgttgcactgatgagttccgtgcccgggctgat
gaactccacaggaactcaaggaaagatgcagcaaaacactacatagaattttggaagaca
attcctccaactgagccatatcgtgtgattcttggtgatgtgagggataaactgtatcac
acacgtgagcgctctcgtcaattgctgagtaacggaatctctgacattcctgaagaagct
actttcaccaatgtggaacagttcttggagcctcttgagctctgttaccgttcactttgt
tcatgtggtgaccgcccaatagctgatggaagccttcttgatttcttgaggcaagtctct
acctttggactctcccttgtgagagttgacattaggcaagagtctgaacgccacacagat
gtcttggatgctatcaccaagcatttgggcatcggttcctcctatagagactggtctgaa
gaaggccgacaggaatggcttctagctgaactaagtggaaagcgtccacttttcggacct
gatcttcccaaaaccgaagaaattgctgatgtcctcgacacattcaaagtcatatctgag
cttccttcagactgttttggagcttacattatatctatggcaacttcacctagtgatgtg
cttgcggttgagcttttgcagcgtgaatgccatgtgaaaaagccacttagagttgttcca
ctctttgagaagctagctgatcttgaagcagctcctgcagccgttgctagactcttttct
attgactggtacaaaaaccgtattaacggtaaacaagaggttatgatcggttactcagat
tcaggcaaagatgcaggacgtctctcagctgcttgggagctatacaaagctcaagaagag
cttgtgaaggttgctaaggaatatggagtgaagctgacaatgttccatggccgtggtggc
acagtcggaagaggaggtggtcccactcatcttgctatattgtctcagccgccggataca
gttaatggctctcttcgagtcacagttcagggtgaagtcattgagcaatcatttggagag
gaacatttatgctttagaacacttcagcgtttcacagctgcaactttagagcacggaatg
aaccctccaatttcaccaaaacctgaatggcgtgctttgctggatgaaatggcggttgtt
gcaactgaggaataccgatctgttgttttccaagaacctcgatttgtcgagtacttccgc
ctggctactccggagctggagtatggacgtatgaacattggaagtagaccttcaaagcgg
aaaccaagcggtgggattgaatctctccgtgcaatcccatggatttttgcatggacgcaa
acaagatttcatcttcccgtatggttaggtttcggagcagcttttaggtttgcgattaag
aaagatgtgcgaaacctccacatgctgcaagatatgtacaagaactggccatttttccga
gtcaccattgatctaattgaaatggtgttcgccaagggagaccccgggattgctgctttg
tacgacaaacttcttgtctcagaagatttatgggcttttggagagaaactcagagccaac
tttgaagaaaccaagaacctcgtcctccagactgctggacatagagatcttcttgaagga
gacccttacttgaaacagagactgaggctgcgtgactcttacattacgaccctcaacgtt
tgccaagcgtacacattgaagaggatccgtgatccaaactacaatgtgaccctgcgacca
cacatttccaaagagatcatgcaatcaagcaagtcagcacaagagctcgtcaagcttaac
ccaacgagtgaatacgcgccaggacttgaggacacactcatcttaaccatgaagggtatc
gccgcaggattgcaaaacaccggttaa

DBGET integrated database retrieval system