KEGG   Capsella rubella: 17894115Help
Entry
17894115          CDS       T02984                                 

Definition
(RefSeq) DNA ligase 6
Organism
crb  Capsella rubella
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 17894115
NCBI-ProteinID: XP_006300589
UniProt: R0GCM7
LinkDB All DBs
Position
Unknown
AA seq 1405 aa AA seqDB search
MVSDSGGTTIAGNSETLSLDSTNLYSSAISSISPQFPPPKPPFSSLSIPQSKRIPKTNFI
VDLFRFPQHSSSSSSVAFFLSHFHSDHYSGLSSSWSRGIIFCSHKTARLVEEVLQVPSQF
VFALPMQQTVLIDGSEVVLIDANHCPGAVQFLFKVTLEEDGGFERYVHTGDFRFCDEMRF
DSFLSGFVGCDGVFLDTTYCNPKFVFPTQEESVGYVVSVVDKISEECVETKKKVLFLVAT
YVIGKEKILIEVARRCKRKIVVNARKMSILGILGCGEDGMFTEDENESDVHVVGWNVLGE
TWPYFRPNFVKMNEIMVEKGYDKVVGFVPTGWTYEVKRNKFAVRIKDSMEIHLVPYSEHS
NYEELREYIKFLKPKRVIPTVGVDIETLDSKEVNKMQKHFSGLVDEMANKKDFLLGFYRQ
SYQKNEKNDIDVVSHLTEVYEGGDKKACEDGGDNVPSSRGSLLHDTAQNSDSLVTERLLV
EVRASLPAWVTEEQMLDLIKKHDGDPVEIVSNFYECEAELYKQSSLHGPSFENQAVLSVD
DVTDLQPNPPLKSTCPDVQAIQKGLDLPRKMNLTKGTISPGKRGKSSGSKSNKKAKKDPK
SKSVGPRQPTIFKFFNKVLDSGSNSVGVGSETEHCNTDKKMAQNDATEAYKEVTDQFIDI
VNGSEALRDYAASIIDEAKGDINRALNIYYSKPSEVPGEHAGEAGLFSKTIQFPECPQAC
SSQEDEKASEKSGYKINICVQTSAEEIVDNNYVSLPPEKYKPKEHACWREGQPAPYIHLV
RTFASVEGEKGKIKAMSMLCNMFRSLVALSPEDVLPAVYLCTNKIAADHENIELNIGGSL
ISSALEEACGINRSTVRDMYNSMGDLGDVAQLCRKTQKLLVPPPPLLVRDVFATLRKISV
QTGTGSTRQKKNLIVKLMRSCREKEIKFLVRTLARNLRIGAMLRTVLPALGRAVVMNSLW
NCHTIEPSESCFREKLEGVSAAVVEAYNILPSLDVVVPSLMDKDIEFSTSTLSMVPGIPI
KPMLAKIAKGVQEFFNLFQDKAFTCEYKYDGQRAQIHKLRDGTVRIFSRNGDETTSRFPD
LVYVIKQFSCPVAETFMLDAEVVATDRMNGNKLMSFQELSTRERGSKDALITTESIKVEV
CVFVFDIMFVNGEQLLALPLRERRRRLKEVFPETRPGYLEYAKEITVGAKEASLDNQDTL
NKINAFLEEAFHSSCEGIMVKSLDVDGGYCPTKRSDSWLKVKRDYVDGLGDTLDLVPIGA
WHGNGRKAGWYSPFLMACFNPETDEFQSVCRVMSGFSDTFYIEMKEFYSGDKILAKKPPY
YRTGETPDMWFSSEVVWEIRGADFTVSPVHSAALGLVHPSRGISVRFPRFIRKVTDRNPE
ECSTAADIAEMFHAQTRKMNITSQK
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atggtctccgattccggcggaaccacaatcgccggcaactcagaaaccctaagcctcgac
tcgacaaatctctactcatcggcaatctcctctatctctccgcaattccccccaccgaaa
ccaccgttctcatctctttcaatccctcaatcaaaacgaatccccaaaactaacttcatc
gtcgatctctttcgcttcccacaacactcctcctcctcctcctccgtggctttcttcctc
tcacatttccactccgatcattactccggtctctcctcttcttggtctagaggaatcatc
ttctgctctcacaaaaccgctcgtctcgttgaagaagttcttcaagttccttcacagttc
gtcttcgctttgcctatgcaacaaacggttttgatcgatggctctgaagttgtgttgatt
gacgcgaaccactgtcctggagcggtacagtttttgtttaaagtcacattggaggaggat
ggtggatttgagaggtatgttcatactggagattttagattctgtgatgagatgagattt
gattcgtttcttagtggttttgttggttgtgatggtgtgtttctggatacgacttattgt
aatcctaagtttgtgtttccgactcaagaggaatctgttggttatgtggttagtgtggta
gataagattagtgaggagtgtgtggagacgaagaagaaggttttgtttcttgttgctact
tatgttattggtaaagagaagattcttattgaggttgctaggagatgtaagaggaaaatc
gttgtgaatgccaggaagatgtcgattttggggattttggggtgtggagaggatggaatg
tttacagaggatgagaatgagagcgatgttcatgttgtgggatggaatgtgttgggtgag
acttggccgtattttaggccgaattttgtgaagatgaatgagattatggttgagaaaggg
tatgataaagttgtaggttttgtgcctacagggtggacttatgaagtgaagcggaataag
tttgcggttagaattaaagattcgatggagattcatcttgtaccatatagtgagcattcg
aactatgaagaacttagagagtacataaagttcttgaaacctaagagagttattcctaca
gttggagttgatatcgagactcttgatagcaaggaggttaataagatgcagaaacatttc
tctggattggtagatgaaatggccaacaaaaaagattttttattgggtttctatcgccaa
tcttaccagaagaatgagaaaaatgatatagatgttgtgtcacacttgactgaggtttac
gaagggggagataaaaaagcatgtgaagacggtggagataatgttccatcatctagagga
tccttattgcatgatacagctcaaaatagtgattctttggtgactgaaagattgctggta
gaagtacgtgcttctttgcctgcttgggttactgaagaacagatgttagatctaattaag
aagcatgatggtgatcctgtggaaatagtaagtaacttttatgaatgtgaagcagagctt
tacaagcaatcttctctccacggaccttcctttgaaaatcaggctgttttgtctgtggat
gatgtaaccgacttgcaaccaaatcctcctttgaagagcacttgtccagatgttcaagca
attcaaaaaggtcttgacttaccaagaaaaatgaatttaactaagggtaccatttctcct
gggaaaagaggcaaaagctcgggcagtaagtcaaacaaaaaagcgaagaaagatccaaaa
tcaaaatcagttggtccgaggcagccaaccatttttaagttcttcaataaggtcttggat
agtggatctaattctgttggtgttggttcagagaccgaacactgcaatacagataaaaag
atggcccaaaatgatgctacagaagcatacaaagaagtgacagatcaatttattgatatt
gtcaatggctctgaagctttaagagattatgctgcgtccatcattgatgaggctaaagga
gatataaatagggcattgaacatctattatagcaaacccagtgaagtacctggtgagcat
gcaggtgaggcaggactctttagcaaaacgatccagtttccggaatgtccacaagcatgc
tcctctcaggaggacgaaaaggcgtcagaaaaatcaggatataaaattaacatatgtgtg
cagacatcagcagaggaaattgtggacaataattatgtatctctacctcctgaaaaatat
aaacctaaagagcacgcttgttggagggagggacaaccagctccatatatacaccttgtc
cgaacatttgcttctgtggaaggtgaaaaaggcaagatcaaagctatgtctatgctttgc
aacatgtttagaagcttggtggctctctctccagaagatgttctgcccgctgtttatcta
tgcacgaataagattgccgctgaccatgagaacattgagcttaacattggtggaagtcta
atctcttctgcattggaagaagcatgtggaataaatcggtctactgtgagagatatgtat
aatagcatgggagatcttggggatgttgctcagttatgtcgaaaaacgcaaaagctactg
gttcctccacctccacttctagttagagatgtgtttgcaactctacgaaagataagtgtg
cagacaggtactggaagtactaggcaaaagaaaaatctcatcgtgaagctaatgcgctct
tgtagagaaaaagaaatcaaatttcttgttagaacattggcccgtaatttaaggattggc
gctatgttgagaactgttctgcctgcacttgggcgagcagtcgttatgaattctctctgg
aattgccataccatagaaccatcagaaagttgtttcagagagaaactcgagggtgtttct
gctgcagtagttgaggcttacaacattcttccttctctggacgtggttgttccttctctc
atggacaaagacattgaattttcaacgtcaactctgtcaatggtcccggggatacctata
aaacccatgctcgcaaaaattgctaaaggggtacaagaattttttaacctcttccaagac
aaggcttttacttgtgaatacaaatatgatggccagcgtgcccagatccataagttacgt
gatggtactgtgcgtatcttttctcggaatggggatgaaacaacttccagatttccagat
ttggtttatgtcataaaacagttttcttgccctgtcgctgagacattcatgttggacgca
gaggtggttgccactgatagaatgaatggaaacaaactcatgtcattccaagagttatca
acaagggagagagggagcaaagatgccttgataactactgaaagtattaaggttgaagtc
tgcgtcttcgtgtttgatattatgttcgtcaatggagaacagctgttggctcttcccctc
cgagagagacgaagacgtctaaaggaggtcttccctgagactaggccaggttatcttgaa
tatgctaaggaaataactgtgggagcaaaagaagcgtccttggataatcaagacactttg
aataagataaatgcttttcttgaagaagcatttcattcatcttgtgaaggaatcatggtc
aagtctttagatgttgatggtggatactgccccacaaagcgctctgattcatggctcaag
gttaagcgtgattatgtagatggattgggcgacacattggatttagttcctataggtgct
tggcatggcaacgggagaaaagcaggatggtatagtccattccttatggcctgcttcaac
cctgagactgatgaatttcagagtgtctgccgtgtcatgtctggtttttctgataccttt
tacatcgagatgaaagaattctactccggggataagatccttgcgaaaaagccgccttac
tacagaacaggggagacacctgacatgtggttttcctcagaggttgtttgggaaatcaga
ggtgcagatttcacggtctcgcctgttcacagtgccgcattaggtctcgtccatccatct
cgaggcatctctgttaggtttccgaggtttattcgtaaagtgacagatagaaatcctgag
gaatgcagcactgctgcggatatcgcagagatgtttcatgctcaaaccagaaaaatgaac
atcacttctcaaaagtag

DBGET integrated database retrieval system