KEGG   Capsella rubella: 17895116Help
Entry
17895116          CDS       T02984                                 

Definition
(RefSeq) glutathione S-transferase U19
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
crb  Capsella rubella
Pathway
crb00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    17895116
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:crb02000]
    17895116
Enzymes [BR:crb01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     17895116
Transporters [BR:crb02000]
 Other Transporters
  Pores ion channels [TC:1]
   17895116
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N GST_C GST_C_2 GST_N_3 GST_N_2 GST_C_3 GST_C_5 GST_C_6 GST_N_4
Motif
Other DBs
NCBI-GeneID: 17895116
NCBI-ProteinID: XP_006302801
UniProt: R0I0I8
LinkDB All DBs
Position
Unknown
AA seq 219 aa AA seqDB search
MTNEVILLDFWPSMFGMRTRIALREKGVEFEYREEDLRNKSPLLLQMNPIHKKIPVLIHN
GKPVNESIIQVQYIDEVWSHKSPILPSDPYQRAQARFWADFIDKKMYDAQRKVWATKGEE
QETGKKDFIEILKTLESELGDKPYFAGDDFGYVDIALIGFSTWFPAYEKFGNFSVEQECP
KLTAWVKKCLQRESVAKSLPEPEKVTEFVSMLRTKFVAE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atgacgaacgaggtgatccttcttgatttctggccaagtatgttcgggatgaggacaagg
atcgcgttgagggagaaaggtgtcgaatttgagtacagagaagaggatctgaggaacaag
agccctctgcttctccagatgaaccccatccacaagaagattccggttctcatccacaat
ggcaaaccggttaacgaatctatcattcaggttcagtacattgacgaggtctggtctcac
aagagccctatcctcccttctgatccttaccagagagctcaagctaggttctgggctgat
ttcatcgacaaaaagatgtacgatgctcagaggaaggtgtgggcgaccaaaggtgaggag
caagagacagggaagaaggatttcattgagatactcaagacgcttgagtctgagcttgga
gacaaaccctactttgctggagatgacttcggctatgtagacattgcattgattggtttc
tccacctggtttccagcatacgagaagtttggtaacttcagcgttgaacaagagtgtccg
aaactgactgcttgggtcaagaagtgtttgcagagggagagcgtggccaagtccttgcct
gagcctgagaaggttaccgagttcgtctccatgctcaggacgaaatttgtagctgagtag

DBGET integrated database retrieval system