KEGG   Capsella rubella: 17899372Help
Entry
17899372          CDS       T02984                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
crb  Capsella rubella
Pathway
crb00010  Glycolysis / Gluconeogenesis
crb00020  Citrate cycle (TCA cycle)
crb00620  Pyruvate metabolism
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
crb01200  Carbon metabolism
Module
crb_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    17899372
   00020 Citrate cycle (TCA cycle)
    17899372
   00620 Pyruvate metabolism
    17899372
Enzymes [BR:crb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     17899372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H FAM101
Motif
Other DBs
NCBI-GeneID: 17899372
NCBI-ProteinID: XP_006307286
UniProt: R0ICH7
LinkDB All DBs
Position
Unknown
AA seq 464 aa AA seqDB search
MSRLLQTPFLPSVSLPTKTRSSIPGFRVKPRTIPIQAKIREIFMPALSSTMTEGKIVSWV
KSEGDKLNKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAPVGSAIALLAETEDEI
ADAKAKASGGGGGGDSKAPPPPSPPPAAVEAPVAVEKKVAAPVKAVAASAVHPASEGGKR
VVASPYAKKLAKELKVELAGLVGSGPMGRIVAKDVEAAVSDGGSVQAAVAVKEVAAAPGV
ELGSVVPFTTMQGAVSRNMVESLAVPTFRVGYTITTDALDALYKKVKSKGVTMTALLAKA
TALALARHPVVNSSCRDGNSFVYNSSINVAVAVAIDGGLITPVLQNADKVDIYSLSRKWK
ELVDKARAKQLQPQEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPSVVATKD
GRIGMKNQMQVNVTADHRVIYGADLALFLQTLASIIEDPKDLTF
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcttctccaaacaccattcttaccctccgtgtctctccccacaaaaacacga
tcttccattccgggtttccgggtaaagcccagaacaatcccaatccaagcaaagatccga
gaaattttcatgcctgcgttaagttcgacgatgaccgaaggcaaaatcgtatcttgggtt
aaatccgaaggcgataagctaaacaaaggtgagagtgttgttgttgttgaatctgataaa
gctgatatggacgttgagactttctacgatggttatctcgctgcaatcatggttgaagaa
ggtggtgttgctcctgttggttccgctattgctttattagctgaaactgaggatgagatc
gctgatgctaaagctaaagcttccggtggtggtggtggtggggattctaaagctcctcct
ccgccttctcctcctccggctgctgttgaagcacctgtggctgttgagaagaaggttgcg
gcgccggttaaggctgtggctgcgtctgcggttcatccggcgtctgaaggagggaagagg
gttgttgcgtctccgtatgctaagaagttagctaaggaattgaaggttgaattggctggt
ttagttggaagtgggccgatgggaaggattgtggctaaagatgttgaggctgcggtttca
gacggaggaagtgttcaagctgcggtggctgttaaggaggtagcggcagctcctggtgtg
gagctgggatcggtggttccgtttacgacaatgcagggggctgtgagcaggaatatggtg
gagagtcttgctgttcccacatttagagttggatacacgattactaccgatgctcttgat
gctctctacaagaaggttaagtcgaaaggtgtgacaatgacggcactcctagctaaggca
actgcactcgcactggcaagacatccggttgtgaactcttcctgtagagatggtaacagt
tttgtgtataacagtagcatcaacgttgctgttgctgttgctattgatggtggtctgatc
actccggtgcttcagaacgctgacaaggttgacatttattcattgtctagaaaatggaaa
gaattggttgataaggcccgagccaagcagctacagcctcaggagtacaacactggtacc
ttcactctatctaaccttggaatgtttggcgtcgatcggtttgatgccattctaccccct
ggaactggagcgatcatggctgtaggagcatctcaaccttcagtggttgctactaaagac
ggccgcattggcatgaaaaaccagatgcaggtgaatgtgacggcagatcatcgtgtcatc
tatggtgctgatctcgcactgttcttgcaaacactggcgagcattattgaggacccaaag
gacctgacattctag

DBGET integrated database retrieval system