KEGG   Capsella rubella: 17900088Help
Entry
17900088          CDS       T02984                                 

Definition
(RefSeq) aldehyde dehydrogenase family 2 member B7, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
crb  Capsella rubella
Pathway
crb00010  Glycolysis / Gluconeogenesis
crb00053  Ascorbate and aldarate metabolism
crb00071  Fatty acid degradation
crb00280  Valine, leucine and isoleucine degradation
crb00310  Lysine degradation
crb00330  Arginine and proline metabolism
crb00340  Histidine metabolism
crb00380  Tryptophan metabolism
crb00410  beta-Alanine metabolism
crb00561  Glycerolipid metabolism
crb00620  Pyruvate metabolism
crb00903  Limonene and pinene degradation
crb01100  Metabolic pathways
crb01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:crb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    17900088
   00053 Ascorbate and aldarate metabolism
    17900088
   00620 Pyruvate metabolism
    17900088
  09103 Lipid metabolism
   00071 Fatty acid degradation
    17900088
   00561 Glycerolipid metabolism
    17900088
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    17900088
   00310 Lysine degradation
    17900088
   00330 Arginine and proline metabolism
    17900088
   00340 Histidine metabolism
    17900088
   00380 Tryptophan metabolism
    17900088
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    17900088
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    17900088
Enzymes [BR:crb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     17900088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh DUF1487 BMC
Motif
Other DBs
NCBI-GeneID: 17900088
NCBI-ProteinID: XP_006307216
UniProt: R0ICC1
LinkDB All DBs
Position
Unknown
AA seq 532 aa AA seqDB search
MASRRVSSLLARSFMPSSSSLLSLRGMNRGVQRYSNHAVENTITPPVKVEHTQLLIGGKF
VDAASGKTFPTLDPRNGEVIAQVAEGDVEDVNRAVAAARKAFDEGPWPRMTAYERSKILF
RFADLIEKHNDEIAALETWDNGKPFEQAAKIEVPMLARVFRYYAGWADKIHGMTVPGDGP
YHVQTLHEPIGVAGQIIPWNFPLLMLSWKLGPALACGNTLVLKTAEQTPLSALLVSRLLH
EAGLPDGVVNIVSGFGATAGAALASHMDVDKVAFTGSTDVGKIILDLASKSNLKSVTLEL
GGKSPFIVCEDADVDQAVELAHFALFFNQGQCCCAGSRTFVHERVYDEFVEKAKARAVKR
AVGDPFKSGIEQGPQIDSEQFNKILKYIKHGVDAGATLQAGGDRFGSKGYYIQPTVFSDV
KDDMLIATDEIFGPVQTILKFKDLDEVIARANNSKYGLAAGVFTQNLDTANRLMRALRVG
TVWINCFDVLDATIPFGGYKMSGIGREKGLYSLSHYLQVKAVVTSLKNPAWL
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcaagaagagtttcatcgttgcttgctcgctccttcatgccctcgtcttcttct
ctgttatctcttagaggtatgaacagaggagtgcagagatacagtaaccatgctgttgaa
aacactattactccacctgtgaaagttgaacacacacagctcttgatcggaggaaaattc
gttgatgcagcctcaggaaaaactttccctactctggatccaaggaatggtgaagtgatt
gctcaggtggctgaaggtgatgttgaagacgtgaaccgtgcggttgcagctgcaagaaag
gcctttgatgaaggaccatggcctagaatgacagcttatgagagatcaaagatactgttt
cgtttcgctgacttgatcgagaaacataacgatgagattgctgctcttgagacttgggat
aatgggaaaccttttgaacaagctgctaaaattgaagtgccaatgcttgctagggtgttc
cgttactatgctggttgggcagacaagatccatggaatgacggttccaggagatggtcca
taccatgtgcagactttgcatgagcccataggagttgctggacagatcatcccatggaac
ttccctcttctcatgctttcttggaaacttggaccagctttagcttgcggaaacactctt
gttctcaagacggctgagcaaactcctctatctgctctccttgtttcaagactacttcat
gaggctggacttcctgatggagttgtgaatatagtttctggatttggtgctacagctggt
gcagccttagctagtcacatggacgttgataaggttgctttcaccggttctactgacgtt
gggaagattattcttgatttggcctcaaaaagcaaccttaagtcagtgactcttgagctt
ggaggcaagtcaccattcatagtatgtgaagatgctgatgtggatcaggccgttgagctt
gcacatttcgctttgttctttaaccagggacaatgctgctgtgctggctcgcgtacattt
gtacatgaacgcgtgtatgatgagtttgtagagaaagctaaagcgcgtgctgtaaaacgc
gctgttggagatcccttcaagtcaggcattgagcaaggtccccagattgactcagagcaa
ttcaataaaatcctgaagtacatcaaacatggagttgatgctggagccacattacaagct
ggaggtgatcgttttggttctaagggttactacattcaacccaccgtcttctcagacgtg
aaagatgacatgctcatagccacagacgagatttttggaccagttcaaaccatattgaag
ttcaaggatcttgatgaggtgattgcaagggcaaacaactccaagtacggtttagctgca
ggagtgttcacacagaatctggacacagcgaacagactgatgcgagcgctgagggttggt
accgtttggattaactgttttgatgtacttgatgctacaattccatttggagggtataag
atgagtggcattggaagagagaagggtctttacagtcttagccattacctacaagttaag
gctgttgtcacatctctcaagaacccggcctggctctaa

DBGET integrated database retrieval system