KEGG   Corynebacterium resistens: CRES_0554Help
Entry
CRES_0554         CDS       T01538                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
crd  Corynebacterium resistens
Brite
KEGG Orthology (KO) [BR:crd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CRES_0554 (ahpF)
Enzymes [BR:crd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     CRES_0554 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like Thi4 DAO K_oxygenase FAD_oxidored Glutaredoxin FAD_binding_3 Thioredoxin_4 Lycopene_cycl NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AEI08916
UniProt: F8DYS4
LinkDB All DBs
Position
complement(680081..681841)
Genome map
AA seq 586 aa AA seqDB search
MGYQRRTGSCSRRLFCFPNSAFTNPPLAVTRSGIEPTTTWQEPPHRVEPVAKEPPPKENP
MAKKLLEDNLSKQLASLMPRITEDVELIYSLDERDASADLKQLLEDIAALSDKVTTREDA
DAHERKPSFTIARKGTDIAVTFAGIPMGHEFSSLVLALLQVGGNPVKEDEELLDAVKGLD
GEYEFVTYMSLSCQNCPTVVQALNAMSVVNPRIKHTAVEGSLFQDEVNDKGVQAVPTVFL
NGEEFVSGRTDIADFVHKLDTGAAARDAKKLNEKGEFDVLVVGQGPAGAAAAIYVARKGM
NVGLVGERFGGQVLDTMSIENFISLKYTEGPKLAAALEDHVNDYEIDVMKAQAATGFTPA
SEQGGVHTVHFGDDATLKARQVVIATGANWRLMNVPGESEYRNKGVTFCPHCDGPLFKGK
DIAVIGGGNSGVEAAIDLAGIVKHVTVLEFGENCRADDVLMDKLNSLDNVDVITSAATTE
IVGDGKSVTGLKYTDRTTDEEKSLELSGVFVQIGLLPNTKWLEGSGIETSGPGEIVVDDH
NATNIPGVFAAGDCTAIPFKQIVVAQGAGANAGLSAWEYSVTGGKK
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
gtgggctaccagaggcggacgggcagctgctcgcgccgcctcttttgttttcccaatagc
gcttttacaaatccacccttggctgtgacgcggtccggaattgaacccactacaacatgg
caagaaccaccccaccgcgttgaaccagtcgcaaaagaaccgcccccgaaggagaatccc
atggcgaagaaacttctcgaagacaatttatccaagcagctagcttccctgatgccacgc
atcactgaagatgtagagctgatttactcactggacgagcgtgacgcttccgctgacctt
aagcagctgttggaggatatcgccgcactctccgacaaagtcacgacccgcgaggatgca
gatgcgcacgagcgcaagccttccttcaccatcgcccgcaagggcaccgacattgccgtg
acgtttgccggaatcccaatgggccacgagttcagctcccttgtactggcgctactgcaa
gtcggtggcaacccagtgaaggaagacgaagagctgttggatgcggtgaagggactcgac
ggtgaatacgagttcgtcacctacatgtccctgtcgtgccagaactgccccaccgtggtg
caggcgctcaacgcaatgtccgtggtcaacccacgcatcaagcacacggccgtggaaggc
tcccttttccaggatgaggtcaacgacaagggcgttcaggcggtgcctaccgtgttcctc
aatggtgaggagttcgtttccgggcgcacggatatcgctgacttcgtccacaagctcgat
accggtgcagccgcccgcgatgcgaagaagctcaatgagaagggcgaattcgatgttctc
gtcgtcggccagggtccagccggcgctgcggccgcgatctacgttgcgcgtaagggcatg
aacgttggcctggttggcgagcgctttggtggccaggtgctagacactatgtccattgag
aacttcatctccttgaagtacaccgaggggcccaagctggccgccgccctcgaggatcat
gttaacgattacgaaatcgatgtaatgaaagcccaggccgccacgggcttcacgcctgcc
tccgaacagggtggcgtgcacaccgttcactttggggacgacgccaccttgaaggcccgc
caggtcgttattgccacgggcgcaaactggcgcctgatgaacgtgcctggtgaatctgag
taccgcaacaagggcgtaaccttctgccctcactgtgatggcccattgttcaagggcaag
gacatcgccgtcatcggcggtggcaactccggtgtggaagctgctatcgatctggctggc
atcgtcaagcacgtcaccgtgctggaattcggtgagaactgccgcgccgacgacgtcttg
atggacaagctgaactccctcgacaacgtggatgtcatcaccagcgccgccaccaccgag
atcgttggtgatggcaagagcgtgaccggcctcaagtacaccgaccgcaccacggacgag
gagaaatccctggagctgtctggcgtgttcgtgcagatcggactgctgccaaacaccaag
tggttggagggctccggcatcgagacttccggtccgggcgagattgtggtggacgaccac
aatgccacgaacatcccaggcgtgttcgcagctggtgactgcacggctatcccgttcaag
caaatcgtagttgcccagggagctggtgctaacgccggtctgagcgcgtgggagtactcg
gtcacgggcggcaagaagtag

DBGET integrated database retrieval system