KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_176829Help
Entry
CHLREDRAFT_176829 CDS       T01039                                 

Definition
(RefSeq) predicted protein
Organism
cre  Chlamydomonas reinhardtii
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_N DNA_ligase_A_C DRMBL DNA_ligase_A_M Lactamase_B_2 RMMBL
Motif
Other DBs
NCBI-GeneID: 5723644
NCBI-ProteinID: XP_001698007
JGI: 176829
UniProt: A8J921
LinkDB All DBs
Position
Unknown
AA seq 1384 aa AA seqDB search
MQRRGSGSRGAGGTAAAGSGGAGPGGGGTAAAVTVPAHKVIPGTGGAVTVDAFRYAHPGV
KAYFLTHAHSDHYTGLSEAWCAGPVYCSELTARLVAHLTGVSTAWLRPLPLGRPVVVEGL
VEVTLVDANHCPGAVQLLFRVLPRGGGGGAAGGGAGGVGGVDATDAAKSAGGSTRGADAG
CSSGAGAVRYLHCGDMRYSPAMQSWPQLGAWRGCEGVFLDTTYCQPKHTFPTQDEAVDYV
ASQIHERTGLRIHVSSTKLDVLRLLLPPEPNPDPDAGVAAAAHVFTDDPAASPVHVVGWG
TLGETWPYFRPNFVNMQRAAEIMGARCVVGFVPTGWTYEMKRSVFSVHSKGALSVHLVPY
SEHSSYPELLEYVKWLRPRQVIPTVGVKEGDREGERARAAMLARFRSLARPAQQRGQGKA
EPFPEEAGVGAGTGAAAGVDAGTAALTGGTSVRAASGGGASEAAAAAPAVKVEPGAQPSA
SPTVQAAPAYGTTTFGDGETASAAAHSTPGKMARTGNDVVELPDTPGPRPPATAPAAPAS
TSAAAATAADAATAAAALAMSWEACREALLLPLERYDPVRHACWGPAHCGDGGAAAANST
SSAAASAAGAASGRGPTPYLHVALCLSALSSTTKRLAISDALTNMFRSVLAAADDPGRDL
VAALYLVTGRIAPEYDKTELNVGGATVSGALQAATGASAARLKQLYREHGDLGDVAAACR
RTQSTLRNPAPLLCGRLLAALRDVAADKGQGVAARRQAVVLGLLRACRDVEVRFLVRTLI
SNLRVGANWRSVLAPLGRAVLLHQRATAAVAAAADGSATTAAVQSPAPAELEAAGAAVLE
AYHTCPNFEILVPVLLRHGIEGLRTRCGLTLGVPLKPMLANACAGPAAEPGEAAGPEEPA
AAEGAAAARVPAQPPGPTPEAGMGTHVTVQVCVFVFDLLEWNGTSLLHRPLRERRSLLPA
ALPGMSPGRVMLATAVELQPLQPLQPSAVDREDGEEGPAAEVPVRMWPAPGEPAAPAVVE
LLSSDEDGPGSEGPYGRPHADDTGAPPAPEHSKAAAVGGHDPAAAAAQQPPCQPGPPSMG
ASRAVMDMLLQSFNTGAEGLMLKRLDGASAYEPSRRSEAWIKASSECVCVKRDYCEGLRD
SVDVVPIGAWYGQGRKVKWFSPFLLAVWDPVREEFQSLCRCMSGFSDQFYAAAKERLGAT
IIPGPKPYYNTGERCSVWFEPTEVWELRGADLTLSPVHRAASGRLHTERGVGMRFPRFIR
VRDDKRPEDATTPDDIVHLYNKQTRKVVVGERGGGDVGRAAGAARPATGCGGAAAVQAQG
AQGAGASKRSGRGRDNQTHGGNAATAREPLIPPAGRLDSVTVSAGVCGLYHNGSNSRWHE
SLLK
NT seq 4155 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccgcggatctggaagtcgtggcgctggcggaactgcggccgcaggcagcgga
ggagcagggcctggcggcggcggcacagccgcagcagtgacggtgccggcgcacaaggtc
attccgggcacgggcggcgccgtgacggtggatgcgtttcgctacgcccacccgggcgtc
aaggcctacttcctgacacacgcgcacagcgaccactacactggcctgagtgaggcctgg
tgcgcgggccccgtgtactgctccgagctgacggcccgcctagtggcgcacctcaccggc
gtcagcacagcctggctgcgaccgctgccgctggggcggcccgtggtggtggagggcctg
gtggaagtgacgctggtggatgccaaccactgcccgggggcggtgcagctgctgttccgt
gtgctgcccaggggcggcggcggcggcgctgccggaggaggggcaggaggagtcggaggg
gtcgatgccaccgacgcggcgaaaagtgccggcggcagtaccagaggtgctgacgctggc
tgtagcagtggcgcgggcgcggttcgctacctgcactgcggcgacatgcgctacagcccc
gccatgcagtcgtggccgcagctgggcgcctggcgggggtgcgagggcgtgttcctcgat
accacctactgccagcccaaacacaccttcccaacccaggatgaggcggtggattacgtg
gccagccagatccatgagcgcaccggcctgcgcatacacgtgtcctccaccaagttggac
gtgctgcggctgctgttgccacccgagccaaacccggacccggacgctggggtcgcagcc
gcagcacacgtgttcacggacgaccccgccgcctcgcccgtgcacgtggtgggatggggc
acactgggcgagacgtggccctacttccggcccaacttcgtcaacatgcagcgtgccgct
gagatcatgggcgctcgctgcgtggtgggattcgtgcccacgggctggacctacgagatg
aagcgctcggtgttctcggtccacagcaagggcgcgctgtcggtgcatctggtgccctac
tcggagcactccagctacccagagctgctggaatatgtcaagtggctgcggccgcgccag
gtcattcccactgtgggcgtcaaggagggcgaccgcgagggcgagcgagcacgtgccgcc
atgctggcgcgcttccgcagcctggcgcggccggcccagcagcgcggccagggaaaggca
gagccgttccctgaggaagctggcgtgggcgcgggcactggcgcggcggcgggcgttgat
gctggcacagcagctctgacgggcggcacgtcggtacgcgcggcatcaggaggtggggcc
agcgaggccgcggccgcagccccagcagtcaaggtcgagcctggtgcgcagccaagcgcc
agccctacagtgcaggcagctcctgcgtatgggaccaccacgttcggcgatggggaaaca
gcttcggccgcggcgcacagcacgccaggcaagatggcccgcaccggcaacgatgtggtc
gagctacctgatacacccggtcctagaccaccggccacagccccggccgcacccgcctcc
acatctgctgcagcagccacagctgctgatgctgctacagccgcagccgcgctcgccatg
tcgtgggaggcctgtcgtgaggcgctactgctgccgcttgagcgctacgatcctgtgcgg
cacgcttgctggggcccggcgcactgcggcgacggcggcgcagccgccgccaacagtacc
agcagcgcagccgcctccgccgcaggcgcagcctccggccgcggccccacgccgtacctg
cacgtggcgttgtgcctgtctgctctgagttccaccaccaagcgcctggccatttcggac
gcgctgaccaacatgttccggtcggtgctggcggcggcggacgacccaggtcgcgaccta
gtggcggcgctgtacctggtcacaggccgcatcgcgcccgagtacgacaagacggagctc
aacgtgggcggcgctacggtaagcggcgcgctgcaggccgccacgggcgcctccgccgcg
cggctcaagcagctgtaccgcgagcacggagacctgggcgacgtggcggcggcctgccgc
cgcacgcagtccacgctgcgcaacccggcgccgctgctgtgtgggcggctgctggcggcg
ctgcgggacgtcgcggcggacaaggggcagggcgtggcggcgcggcggcaggcggtggtg
ctggggctgctgcgcgcctgccgcgacgtggaggtccggttcctggtgcgcaccctcata
tcgaacctgcgtgtgggcgccaactggcggagcgtcctcgcgcccctgggccgcgccgtc
ctgctgcaccagcgggccacagccgcggtggcggccgccgctgacggctcggctactaca
gccgccgtgcaatctccagcacccgcggagctggaggcggcgggggcggctgtgcttgag
gcctaccacacctgccccaactttgagatcctggtgccggtgctgctgcggcacggcatt
gagggcctgcgcaccaggtgcggtcttacgctgggcgtgccgctgaagcccatgctcgcc
aacgcctgtgctgggcctgcggcggagcccggggaagcggcaggccccgaggagccggcg
gcggcagagggggctgcggcggcgcgtgtgccagcacagccgccaggccccactcctgaa
gcgggcatgggcacacacgtgacggtgcaggtgtgcgtctttgtgtttgacctgctggag
tggaacggcacctcgctgctgcacaggcccctgcgcgagcgccgctcgttgctgcctgcc
gccctgcccggcatgtcgcctgggcgcgtcatgctggccacagccgtggagctacagccg
ctgcagccgctgcagccgtcggcagtggacagggaggacggcgaggaggggccggcagcc
gaggtgccggtccgtatgtggccggcgcccggggagcctgccgcaccagccgtggtggag
ctgctgtcttcagacgaggacggcccaggcagcgaaggcccctacggccgcccgcacgcg
gatgacactggcgcgccgccggcacctgagcactccaaggcagcggctgtcggtggtcac
gacccggcggcggcagccgcacagcagccaccttgccaacccgggccgccgtccatgggc
gcatccagggcggtcatggacatgctgctgcagtctttcaacacaggggcagaaggcctg
atgttgaagcgcttggatggcgcctccgcctacgagcccagccgccgcagcgaagcctgg
atcaaggcaagtagcgaatgtgtgtgtgtgaagcgggactactgcgaggggctgcgggac
agtgtggacgtggtgcccataggcgcctggtacggtcagggccgcaaggtcaagtggttc
tcgccattcttgctggcggtgtgggacccggtgcgcgaggagttccagtcgctgtgccgc
tgcatgagcggcttcagcgaccagttctacgcagcggccaaggagcggctgggcgcgacc
atcatcccaggccccaagccctactacaacacaggcgagcggtgcagcgtttggttcgag
ccaacggaggtgtgggagctgcgcggagcagacctgacgctgtctccggtgcatcgcgct
gcctctgggcggctgcacactgagcgtggcgtgggcatgcgcttccccaggttcattcgc
gtgcgtgacgacaagcggcccgaggacgccaccacgcccgacgacatcgtgcacctgtac
aacaagcagacgcgcaaggtggtggtcggggaacgtggcggcggtgacgttgggagggcc
gccggagcagcccggcccgccaccggctgtggcggggccgcagccgtgcaggcgcaaggt
gcccagggcgccggcgccagcaagcggagcggccgcggtcgcgacaaccaaacacatgga
gggaacgcggcgactgcgagggagcctctgattcccccggccggtcggctggacagtgtc
actgtgtcagctggcgtgtgtgggctgtaccacaatggatccaattcaagatggcacgag
tctttgctgaagtag

DBGET integrated database retrieval system