KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_191388Help
Entry
CHLREDRAFT_191388 CDS       T01039                                 

Definition
(RefSeq) histone methyltransferase
  KO
K11423  histone-lysine N-methyltransferase SETD2 [EC:2.1.1.43]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    CHLREDRAFT_191388
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:cre03036]
    CHLREDRAFT_191388
Enzymes [BR:cre01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     CHLREDRAFT_191388
Chromosome and associated proteins [BR:cre03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     CHLREDRAFT_191388
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 5720253
NCBI-ProteinID: XP_001694743
JGI: 191388
UniProt: A8J069
LinkDB All DBs
Position
Unknown
AA seq 1105 aa AA seqDB search
MGRRRSYSDSESETSLSGSPSASDASDTDDSAQQRGRKGEQAEPGETEQNWVLCDSCTKW
RRVPAPYANSLDEDASWYCALNPNKAFASCSVPQELTDEQIDAGGDSGGESELDEEEGLK
RRRIPAVWQLLKDNVLTHRKRKVQDEDDIMICHCKPVWRGGDGCGPDCINRMLCIECVPG
FCPSEDKCTNQMFSKRMYANLEIRRAGAKGFGLFALEDIKAGQFIIEYIGEVLEEDEYQR
RKEYYMSVGQRHYYFMNIGNGEVIDACRKGNISRFINHSCEPNCETQKWLVHGELAIGLF
AVRDIPKDTELTFDYNFERYGDKPMRCYCKSGGCRKFIGGTQDNFDVSLLPAVETVEDAT
HDWPPIMLGETDMDPNMRMLLDWRVGTRVDRPKEMGMVTRLERLCKARNVNWTVDYFYNP
TFVPVQKQSAQPLILPPELPTAQAVTGKGAGAAQQQTSGGSGKAEKDKPGADSTPAPSTA
KSKQQRKAEKAAATATAGKGKASAAKQDKQDKQRAEGGAAAVSKLQLEDGAAAGPGPGSL
AQAMAGTPQFRGPKALFKQWKIMQQQDATPAPAVEEKPAAAPSSPPSPRSPRSQSPSPSQ
RSGGADAEAGLEDEDAEVEVRAAAAAAAKHAPLRKRLKRLPVKKPPPPAPVPEAPQQQNG
SAAKASARKQSMDRSASPARSSEIDRRLDEVVGATGRLKDPSRQNIIKRARMADLSLLLD
VVLKTTSSAAKKDFVTCGLLTQLHQAMGRNTGKEYCVILRKVLRVVEALPLEANDVYSVR
SAHGNFADMLRQLSTNADYDVRTKAAALLKKFPPSAVTDQRLLQLMAAPPGDAASSLSDM
TACCCWSPLVAVDGADVAMSPLVETAAAGTNEALPPPPPLPLPPGVSGNANGPPLGEGGV
PLRPLRTTSTMGVAAAAGPSGAAGQEENIDEWLRPVSTSHLEVWEEPDSSFEAYVADMVR
HRLGKYMQPEHPSRVSVQEATALRAKVYREVVAKERRAWEERRSAGVFKPIERHKLESNL
KEFATEAAIATAEAPTPATAHPVVAAAEPAAQPAEQSNGGDVVAPGDHVMGEVEEEPLTP
PEEETRAEAAAVRDVVMAAGRASCQ
NT seq 3318 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggcgacggagttactcggattctgagtctgagacgtcgctgagcgggtcgccc
agtgcttcagacgcctcagacacggatgactcagcgcagcagcgaggccggaagggcgag
caggcggagcctggcgagactgagcaaaattgggttctttgcgactcttgcacaaaatgg
aggcgtgtgcccgcaccatatgcaaactccttggatgaggatgcatcctggtactgtgca
ctcaatccgaacaaggcttttgcgagctgcagtgtgccccaggagctcaccgacgagcaa
attgatgctggcggagactctggcggggagagcgagctggacgaggaggaggggctgaag
cgtcggcgcattcccgcggtgtggcagctgctgaaggacaatgtcctgacacaccgcaag
cggaaggtgcaggacgaggacgacatcatgatatgccactgcaagccggtgtggcgcggc
ggggacggctgtgggccggactgtatcaatcggatgctttgcatcgagtgcgtgccgggc
ttttgtccttcggaggacaagtgcaccaaccaaatgttctccaagcggatgtacgccaac
ctggagattcggcgtgcgggcgccaagggctttgggctgttcgcgctggaggacatcaag
gcgggccagttcatcatcgagtacattggcgaggtgttggaggaggacgagtaccagcgg
cgcaaggagtactacatgtctgtggggcagcgccactactacttcatgaacatcgggaac
ggggaggtcatcgacgcctgccgcaagggcaacatctcgcgcttcatcaaccactcatgt
gagcccaactgcgagacgcaaaaatggctggtgcacggcgagctggccatcgggctgttt
gcggtgcgggacatcccgaaggacacggagctgacattcgactacaactttgagcgctac
ggcgacaagcccatgcgctgctactgcaagtccgggggctgccgcaagtttattggcggg
acgcaggacaacttcgacgtgtcgctgctgcccgcggtggagacggtggaggacgccacg
cacgactggccgcccatcatgctgggcgagacggacatggaccccaacatgcgcatgctg
ctggactggcgcgtggggacgcgggtggacaggcctaaggaaatgggcatggtcacgcgg
ttggagcggctgtgcaaggcgcgcaacgtgaactggacggtggactacttctacaacccc
acgttcgtgccagtgcagaagcagagcgcgcagccgctcatcctgccgccggagctgccg
acagcgcaggcggtgacgggcaaaggcgctggagcggcgcagcagcagacgtcgggtggc
agcggcaaggcggagaaggacaagccgggggcggactcgacgcccgcgccgtccacggcg
aagagcaagcagcagcgcaaggcggagaaggcggcagccaccgccacggcgggcaagggc
aaggccagcgcggccaagcaggataaacaggacaagcagcgggcggaagggggtgcggcg
gctgtgtccaagctgcagctggaggatggcgcggcggcggggcctgggccaggcagcctg
gcgcaggccatggcggggacaccgcaattccgcgggcccaaggctctctttaagcaatgg
aagatcatgcagcagcaagatgccacgccagctccagctgtggaggagaagcccgcggcg
gcgccgtcctccccgccctcgccgcgctcgccgcggtcgcagtcgccgtcgccttcccag
cggtctggcggggcagacgcggaagcgggcctggaggacgaggacgcggaggtggaggtg
cgcgcagcggcggcggccgcggccaagcatgcaccgctgcgcaagcggttaaaacggtta
ccggtgaagaagccgccgccaccagcgccagtgccggaggcgccgcagcagcagaacggc
tccgctgccaaggcgtctgcgcgcaagcagtccatggaccgctcagcatcaccagctcgc
tcgtctgagattgaccgccgcctggatgaggtggtgggcgccacggggcggctcaaggac
cccagccggcagaacatcatcaagcgcgcgcgcatggcggacctgtcgctgctgctggac
gtggtgctcaagaccaccagcagcgcggccaagaaggactttgtgacgtgcggcctgctg
acgcagctgcaccaggccatggggcgcaacacgggcaaggagtactgcgtcatcctgcgc
aaggtgctgcgcgtggtggaggcgctgccgctggaggccaacgacgtgtactccgtgcga
tccgcgcacggcaacttcgccgacatgctgcggcagctgtccaccaacgcggattacgac
gtgcgcaccaaggcggcggcgctgctgaagaagttcccgccgtcggcggtgacggaccag
cggctgctgcagctgatggcggcgccgccgggtgacgcggcctccagtctgtctgacatg
accgcgtgctgctgctggtcgccgctggtggcggtggatggcgcagatgttgccatgtca
cccctggtggagacggcggcggccgggaccaacgaggctctaccgccgccgccgcccctt
ccgctaccgcccggtgtcagcggcaacgccaacgggccgccgctgggcgagggcggcgtg
ccgctgcggccgctgcgcaccacgtcaacgatgggcgtggccgctgcagcggggccgagc
ggggcagctgggcaggaggagaacatcgacgagtggctgcggccggtgtccacctcgcac
ctggaggtgtgggaggagccggacagctcctttgaggcctacgtggcggacatggtgcgg
caccgcctgggcaagtacatgcagccagagcaccccagccgcgtgtcggtgcaggaggcc
acagcgctgcgcgcaaaggtgtaccgggaggtggtggccaaggagcggcgcgcctgggag
gagcggcgcagcgcgggtgtgttcaagcccatcgagcgccacaagctggagtccaacctc
aaggagttcgcgactgaagcggccattgcgaccgcagaggcgccgacgcctgctacggcc
catccggttgttgcggcagcggagcctgcggcacagccagcagagcagagcaatggcggt
gatgtggtcgcgccgggtgaccatgtaatgggcgaggttgaggaggagccgctcacgccg
ccggaggaggaaacccgtgcagaggccgctgcggttcgggatgtggtgatggcggctgga
cgcgcctcgtgccagtga

DBGET integrated database retrieval system