KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195972Help
Entry
CHLREDRAFT_195972 CDS       T01039                                 

Gene name
SDH1
Definition
(RefSeq) succinate dehydrogenase subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00020  Citrate cycle (TCA cycle)
cre00190  Oxidative phosphorylation
cre01100  Metabolic pathways
cre01110  Biosynthesis of secondary metabolites
cre01200  Carbon metabolism
Module
cre_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cre_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cre_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CHLREDRAFT_195972 (SDH1)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    CHLREDRAFT_195972 (SDH1)
Enzymes [BR:cre01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     CHLREDRAFT_195972 (SDH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 Herpes_UL69 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 5715870
NCBI-ProteinID: XP_001689842
JGI: 195972
UniProt: A8HP06
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MPVLAKLLGGASKASSLQQLAGLGQRAALAATQQAGFASQSYPVIDHQYDAIVVGAGGAG
LRAAVGLSELGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTIKGSDWL
GDQDAIHYMCREAPKAVIELENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAA
DRTGHAMLHTLYGQAMKHDIQFYVEYFALDLIMDSDGVCRGVMALCMEDGTLHRFQAHQT
VLATGGYGRAYFSATSAHTCTGDGNAMAARAGIPLQDLEFVQFHPTGIYGAGCLITEGSR
GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGCGPEKDHIYLHLNHLP
PELLAERLPGISETAAIFAGVDVTKEPIPVLPTVHYNMGGVPTNYMGEVLAPTPDNPDKV
VPGLFAAGEAACASVHGANRLGANSLLDIVVFGRACANRIGQIMKPNTPHKPLPATAGEG
AVARLDKLRNAKGNLRTAEIRRNMQKVMQNNAAVFRTQESLEEGCKLIDETMASFQDVKT
TDRGLVWNTDLIETLELENLLINAAVTMHSAEKRKESRGAHAREDFTQRDDANWMKHTLG
FLPSTNDKVNISYRPVHMKPLSEEMPFIPPKPRVY
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtgctggcaaagttgctgggcggtgcctccaaggcatcgtccctgcagcaattg
gcgggtcttggtcagcgggcggcccttgccgcgacacagcaggctggtttcgcttcgcag
tcctacccggtgattgaccaccagtatgatgcaattgtcgttggagcgggaggagctggt
ctgcgcgcggcggtgggcctgtcggagctgggcttcaacacagcgtgcatcacgaagctc
tttcctactcgttcgcacacggtcgctgcccagggcggcatcaacgccgcgctgggcaac
atgaccgaggatgattggcggtggcatgcttacgatacaattaagggcagcgactggctc
ggcgaccaggacgcaattcactacatgtgccgcgaggcaccaaaggccgtgattgagctg
gagaactacggcctgccgttctcgcgcacggaggatgggaaaatttaccagcgtgccttc
ggcggccagtcgctggacttcggcaagggcggccaggcgtaccgctgcgcctgcgccgct
gaccgcacaggtcacgccatgctccacacgctttacggccaggccatgaagcacgacatc
cagttctacgtggagtacttcgctctggatctgatcatggacagcgacggcgtgtgtcgc
ggcgtcatggcgctgtgcatggaggacggcaccctgcaccgcttccaggctcaccagacg
gtgctggctacgggcggctacggacgcgcctacttctcagccacctcggcacacacctgc
accggagacggaaacgccatggcggcgcgcgccggcatcccgctgcaggacctggagttt
gtgcagttccaccccaccggcatctacggcgccggctgcctgatcacggagggctcccgc
ggcgagggcggcatcctgcgcaacagcgagggcgagcgcttcatggagcgctacgcgccc
accgccaaggacttggcctcgcgtgacgtggtgtcccgctccatgaccatggagatccgg
gaggggcgcggctgcggccccgagaaggaccacatctatctgcacctcaaccacctgccg
cccgagctgctggcggagcgcctgcccggcatctccgagaccgccgccatcttcgccggc
gttgacgtgaccaaggagcccatcccggtgctgcccacggtgcactacaacatgggcggc
gtgcccaccaactacatgggcgaggtgctggcgcccacgcccgacaaccccgacaaggtg
gtgcccggcctgttcgccgcgggcgaggcggcgtgcgcctcggtgcacggtgccaaccgc
ctgggcgccaactcgctgctggacatcgtggtgttcggccgcgcctgcgccaaccgcatc
ggccagatcatgaagcccaacaccccgcacaagccgctgcccgccaccgccggcgagggc
gccgtggcgcgcctggacaagctgcgcaacgccaagggcaacctgcgtaccgccgagatc
cgccgcaacatgcagaaggtgatgcagaacaacgcggcggtgttccgcacgcaggagtcg
ctggaggagggctgcaagctgattgacgagaccatggcctccttccaggacgtcaagacc
acggaccgcggactggtgtggaacacggacctcatcgagacgctggagctggagaacctg
ctcatcaacgcagcggtcaccatgcactcggccgagaagcgcaaggagtcgcgcggcgcc
cacgcgcgtgaggacttcacgcagcgcgacgacgccaactggatgaagcacacgctgggc
ttcctgccctcgaccaacgacaaggtgaacatcagctaccggcctgtgcacatgaagccg
ctgagcgaggagatgcccttcatcccgcccaagccccgcgtctactaa

DBGET integrated database retrieval system