KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_195975Help
Entry
CHLREDRAFT_195975 CDS       T01039                                 

Gene name
PTN1
Definition
(RefSeq) PTEN PI-3 phosphatase
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00562  Inositol phosphate metabolism
cre01100  Metabolic pathways
cre04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    CHLREDRAFT_195975 (PTN1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    CHLREDRAFT_195975 (PTN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:cre01009]
    CHLREDRAFT_195975 (PTN1)
Enzymes [BR:cre01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     CHLREDRAFT_195975 (PTN1)
    3.1.3.48  protein-tyrosine-phosphatase
     CHLREDRAFT_195975 (PTN1)
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     CHLREDRAFT_195975 (PTN1)
Protein phosphatases and associated proteins [BR:cre01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    CHLREDRAFT_195975 (PTN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase Y_phosphatase3 DSPc PTPlike_phytase PTEN_C2
Motif
Other DBs
NCBI-GeneID: 5716841
NCBI-ProteinID: XP_001691360
JGI: 195975
UniProt: A8IMN8
LinkDB All DBs
Position
Unknown
AA seq 647 aa AA seqDB search
MAFIARRLVSTNKRRYQEDGFDLDLTYITPRIIAMGFPCDGFSSKPPTRSLGCELPNPPP
RPPPYHLEHASKPPPPGSACRQLYRNPAVQVAALLESRHGGGRYRVYNLCVERGYGDPQL
FGGRVVRLPLYDGQAPPLPLLVSMCRDCRDWLGAHPAHVVAVHCKAGKGRTGAAVCALLL
ALRRTRDGKGLTIPSQRRSVEQFHRLLLAALAASTPSAGPPSPAAAHTEAGHPAAGAGAS
SHVGSAALLPGSSTAAPAAAGSSLTAAGLGATDAAAATAAATAAAAAAAAAAAATTAAAA
LDAVEVPHAGVVLRRLVLRGLPEPLLQRCTVAVWWRPSGHYEARPLCCVHTGAPAAAAGG
NGGGGRGGGKDGAGCLGGGAGAGPPGDGQCGSGTGGATWVVKRGAAGGGAGSAPIGSSPM
SHPSSSSNASAPELIIDLTSVPSPPPPPAPTPLPYFQPPDPPPHPPPPSRSSAWPHAAAR
YTGATGASGTHGHSGGAQTGGGSSMAGGSGGGGGGGPLLAGDIKLQLFKGHVVDPAPDIF
KGRVSQFGAWLHTAFMHDLSQQLQQQLPQRQQQPGELGGQQQQQQAAQVAGEQQRWAHGA
QQTAAAAAAGPGGACTLTLTGAQLDKLAKALRKRRPEISVAVEYELH
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggcgttcatcgcaagacgcctggtgtccacgaacaagcggcgctaccaggaggatggc
ttcgacctggacctcacatacataaccccgcgcatcatcgctatgggcttcccttgcgac
ggcttctcaagtaagccgcccacccgcagcctgggctgcgaactcccgaacccaccccca
cgtccgcccccataccacctcgaacacgcgtccaaacccccgccccccggttccgcctgc
cgacagctgtaccgcaacccggccgtgcaggtggcggcgctgctggagtcgcggcacggc
ggtgggcgctaccgtgtgtacaacctgtgtgtggagcgcgggtacggcgacccgcagctg
ttcggaggccgcgtggtgcggctgccgctgtatgacggacaggctccgccgctgccgctg
cttgtgtccatgtgccgcgactgccgcgactggctgggcgcccaccccgcacacgtggtg
gcggtacactgcaaggccggcaaggggcgcaccggcgcggccgtgtgcgcgctgctgctg
gcgctgcggcgcacgcgcgacggcaaggggctcaccatacccagccagcgcaggtctgtg
gagcagttccaccgcctgctgctggccgccctggccgccagcaccccctcagcggggccg
ccctcgcccgcagccgcgcacacagaggcggggcacccagccgccggggccggcgccagc
agccacgtggggtcagcggccctgctccccggctcttctactgctgcacctgccgctgct
ggcagcagcttgacagcagccggtctaggcgccacggatgcagcagcagctactgctgct
gctactgctgctgctgctgctgctgctgctgctgctgccgccactactgcggctgcagca
ttggatgcggtggaggtgccgcatgcgggcgtggtgctgcggcggctggtgctgcggggc
ctgccggagccactgctgcagcgctgcactgtggcggtgtggtggcggcccagcggccac
tacgaggcgcggccgctgtgctgcgtgcacaccggagcacctgccgcagcggcaggcggc
aatggaggcggaggccggggcggcggaaaggacggtgcagggtgcttgggcggcggagca
ggtgcaggcccgccgggcgatggccagtgcgggagcggcaccggtggcgcaacctgggtt
gtcaaacgcggggcggcgggtggcggcgccggcagcgctccaattggcagcagccctatg
agccaccccagcagcagtagcaatgccagcgcgccggaactcatcatagaccttacgtcg
gtgcccagcccgccgccgccaccagcgcccacgccgctgccctacttccagccgccggac
cctcctccccacccgccaccgccctcacggtccagtgcctggccgcacgccgccgcacgc
tacaccggcgccactggtgcgagtggcactcacggccacagcggcggcgcccagactgga
ggcggcagtagcatggcaggtggcagcggtggcggcggcggcggcgggcccctgctggcg
ggcgacatcaagctgcagctgttcaagggccacgtggtggaccccgcgcccgacatcttc
aagggccgtgtcagccagttcggcgcctggctgcacaccgccttcatgcacgacctctcc
cagcagctgcagcagcagctgccgcagcggcagcagcagcctggggaacttggagggcag
cagcagcagcagcaggctgcgcaagttgctggggagcagcaacgttgggcgcatggggcg
cagcagacggcagcggcagcagcagctgggcccggtggcgcctgcaccttgacgctgaca
ggggcgcagctggacaaactggcaaaggcgctgcggaagcgacgacccgagatctctgtg
gcggttgagtatgagttgcactga

DBGET integrated database retrieval system