KEGG   Chlamydomonas reinhardtii: CHLREDRAFT_196947Help
Entry
CHLREDRAFT_196947 CDS       T01039                                 

Gene name
AGL1
Definition
(RefSeq) alpha glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00052  Galactose metabolism
cre00500  Starch and sucrose metabolism
cre01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CHLREDRAFT_196947 (AGL1)
   00500 Starch and sucrose metabolism
    CHLREDRAFT_196947 (AGL1)
Enzymes [BR:cre01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     CHLREDRAFT_196947 (AGL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 NtCtMGAM_N Actino_peptide
Motif
Other DBs
NCBI-GeneID: 5718726
NCBI-ProteinID: XP_001693117
JGI: 196947
UniProt: A8IWM1
LinkDB All DBs
Position
Unknown
AA seq 1059 aa AA seqDB search
MLQVELQQQTPQRLYLRVSPLPSPGGGGAGGAATGQAQSQPHQERWRVPEQLLPRPPPPT
ALPEAPLYQLQLPQPGDDFSLHVTRQPESQAEVAAEAGTEAAVEAAAAGQSLLEVLGGSC
LVFKPQYLQLRMRVPQQTNLYGMGEATLPDGLRLRRDGVARALWNSDTPAAAVGVNLYGS
HPVLYGIVPGSGGTAWGVFLANSNAMEFAAGSNDVTFRLTGGDLELWLLAGPTPEDVSRQ
YLQLVGAPALPPRWALGFHQSRYGYADVSELEAVVAGFEAAQLPLEVLWSDIDMYDRARM
FTTDSERYPVDRLRGLVDRLHGSGRRWVPIVDCGITALPGQAYPPYDRGLAAGVFLRDSG
GRQPLLGQVWSGPTHWPDFLHPNTSEYWGGLLSDMAARLPYDGLWLDMNEPSNFYCGRAP
GTPDDPLSYPPYAVNNGNRRAPLYVNTVPMNAVGYGGVRQYDSHNLYALAEVAVTHGALQ
AILPGSRPFILTRSTWAGSGRYAAHWSGDNGASWEDLARGGGSLLAASLAGISMAGADVC
GFWGATSEQLCARWLAAGSFYTFTRDHSDHSPQEPYRFPAAAQAARNSLRARYALLPYLY
TALYDVHTGRAGTVARPLAWEFPSDPRVADLSTQWLLGDSLLVAPVLRPDTDWTEAVFPA
GARSTWCRLSDLGDCHTGPAQHLVQSPLGSEPPLFLRAGAIIPTQPFRPAATTTAEVAAS
PLALTALLSSASEASGSSSNSSSSGSAEGGGGPPAPLVEEDVDWVAAGRLYADNGTDPRV
DGADCLRVELRAGALLAAGTGYLAYEVQRPPAVAVEAGSSSGRGSQGRGSSSGSSSKLPQ
DGTGSSSGNDSSSGGGGGGVAAGGGVRTAGGGADTDVRLLRVAEVVVVGVVLPPGAGAFE
VQVEVGGQLKPPEQPRGAKRSVKRPGGHSLQSQSQVPRRLAGWAAAGGSSANSRNGGEVV
GMWDGDGAGGGCGHASHQEVMRRRKPAQAQASARGARVPVPATAVEFDPVRQLLRVRGLE
LSAVVSFRLEWKPLTAPPHSTTGFSSVPRWQPEEARAAA
NT seq 3180 nt NT seq  +upstreamnt  +downstreamnt
atgttacaggtggagctgcagcagcagacgccgcagcggctgtacctgcgtgtcagccct
ctgcccagcccaggcggaggaggtgcgggtggtgccgccacaggtcaggcgcagtcgcag
ccgcaccaggagcggtggcgtgttcccgagcagctgctgccgcggcctccgccgcccact
gcgctgcccgaggccccgctgtatcagctgcagctgccgcagcccggagatgacttcagc
ctgcacgtcaccaggcagcctgagtcccaggcggaggttgcggcagaggcaggtacagag
gcggcggtggaggcggcggccgcgggccagtccctgctggaggtgttggggggcagctgc
ctggtgttcaagccgcagtacctccagctgagaatgagggtgccgcagcagaccaacctg
tacggcatgggagaggcgacgctgcccgacgggctgcggctacgccgggacggtgtggcc
cgggcgctgtggaactccgacacccccgctgctgccgtgggcgttaacctgtacggctcc
caccccgtgctgtacggcatcgtgcccggctccggcggtaccgcctggggcgtgttccta
gccaacagcaacgcaatggagttcgcggcgggcagcaatgacgtcactttcaggctgaca
ggcggtgatttggagctgtggctgctggccggccccactcccgaggacgtcagccggcag
tacctgcagctggtgggcgcacccgcactgccgccgcgctgggccctgggcttccaccag
agcaggtacggctacgcggacgtgtccgagctggaggccgtggtggcgggcttcgaggcg
gcgcagctgcctctggaggtgctgtggagcgacatagacatgtacgaccgcgcacgcatg
ttcacaaccgactcggagcgctacccggtggaccgactgcgcggcctggtagacaggctg
cacggcagcggccggcgctgggtgcccattgtggactgcggcatcacggcgctgccgggc
caggcctacccgccctacgaccgcgggctggcggccggcgtgttcctcagagacagcggc
ggccgccagccgctgctggggcaggtgtggtcgggccccacccactggccggacttcctg
caccccaacacctccgagtactggggcggcctgctgtctgacatggcggcccggctgccg
tacgacgggctttggttggacatgaacgagccctccaacttctactgcggcagagccccg
ggcacccccgacgacccgctgtcgtatccgccttacgcggtcaacaacggcaaccgccgc
gcgccgctgtacgtcaacacagtgcccatgaacgcggtcgggtacggcggtgtacggcag
tacgactcacacaacctgtacgcgctggctgaggtggcggtgacacacggcgcgctgcaa
gccatcctgccaggctcgcggcccttcatcctcacgcgttccacctgggccggcagcggg
cgctacgcggcgcactggagcggcgacaacggcgccagctgggaggacctggcgcggggc
ggtgggtcgctgctggcagcctcactggcaggcataagcatggcaggcgcggacgtgtgc
ggcttctggggagccacctcggagcagctgtgcgcacggtggctggctgccggctccttc
tacaccttcactcgcgaccacagcgaccactcgccgcaggagccctaccgcttcccagcc
gccgcacaggccgcacgcaactcgctgcgggctaggtacgcgctgctgccgtacttatac
acagcgctgtacgacgtgcacacggggcgtgccggcacggtggcgcggccgctggcctgg
gagttcccctccgacccgcgcgtggcggacctgtccacacagtggctgctgggcgactcg
ctgctggtggctccggtgctgcggcccgacacggactggacggaggcggtgttcccggcc
ggcgcccgcagcacctggtgccgactgagcgacctgggggactgccacacgggccccgcc
cagcacctggtgcagtcgccactgggctccgagccgccgctgttcctgcgggccggcgcc
atcatccccacccagcccttccgccccgccgccaccaccacagctgaggtggctgcttcg
ccgctcgcccttacagcactgctgtcgagtgctagcgaggccagtggaagcagcagcaac
agcagcagcagcggctctgctgaaggcggcggcggcccgccggcaccactggtcgaggag
gatgtggactgggtggcagcggggcgcttgtacgccgacaatggcacagacccgagggtt
gatggcgcagactgcctgcgggtggagctgcgtgccggcgccctgttggcggcgggtact
ggctacctggcgtatgaggtgcagcggccaccagcagtagcagtggaagccggcagtagc
agtgggcgtggcagtcaggggcgaggcagtagcagcggcagcagcagcaaactgccccag
gacggcacaggaagcagtagcggcaatgacagcagcagtggcggcggcggcggcggtgtc
gcagcaggtggcggcgtgaggactgcaggtggtggcgcggacacggacgtacgactgctg
cgtgtggcggaggtggtggtggtgggagtggtgctgccgccgggtgccggtgccttcgag
gtgcaggtggaggtgggagggcagctgaagccgccggagcagccgaggggtgccaagcgg
agcgtgaagcggcctggcggtcattccctgcagtcgcagtcgcaggttccaaggcggctt
gcggggtgggcggctgctggcggcagctcggccaacagccgcaatggtggagaagtggtt
ggcatgtgggatggcgacggcgcgggaggtggctgcggtcacgcctcgcaccaggaggtg
atgcggcgccgcaagccggcgcaggcgcaggcatcagccaggggggctcgagtgccggtg
ccggcgactgcggtggagtttgacccggtgcgtcagctgctgcgggtccggggcctggag
ctgtcggcagtggtgtcgttccgcttggagtggaagccgctcacagctccgcctcacagc
actacaggcttctcatcagtgcccaggtggcagccggaagaggcccgtgcggctgcctga

DBGET integrated database retrieval system