KEGG   Chlamydomonas reinhardtii: ChreCp049Help
Entry
ChreCp049         CDS       T01039                                 

Gene name
rbcL
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
cre  Chlamydomonas reinhardtii
Pathway
cre00630  Glyoxylate and dicarboxylate metabolism
cre00710  Carbon fixation in photosynthetic organisms
cre01100  Metabolic pathways
cre01200  Carbon metabolism
Module
cre_M00165  Reductive pentose phosphate cycle (Calvin cycle)
cre_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
cre_M00532  Photorespiration
cre_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:cre00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ChreCp049 (rbcL)
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ChreCp049 (rbcL)
Enzymes [BR:cre01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ChreCp049 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 2717040
NCBI-ProteinID: NP_958405
UniProt: P00877
LinkDB All DBs
Structure
PDB: 

Position
CP
AA seq 475 aa AA seqDB search
MVPQTETKAGAGFKAGVKDYRLTYYTPDYVVRDTDILAAFRMTPQLGVPPEECGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYDIEPVPGEDNQYIAYVAYPIDLFEEGSVTNMFTSI
VGNVFGFKALRALRLEDLRIPPAYVKTFVGPPHGIQVERDKLNKYGRGLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFVAEAIYKAQAETGEVKGHYL
NATAGTCEEMMKRAVCAKELGVPIIMHDYLTGGFTANTSLAIYCRDNGLLLHIHRAMHAV
IDRQRNHGIHFRVLAKALRMSGGDHLHSGTVVGKLEGEREVTLGFVDLMRDDYVEKDRSR
GIYFTQDWCSMPGVMPVASGGIHVWHMPALVEIFGDDACLQFGGGTLGHPWGNAPGAAAN
RVALEACTQARNEGRDLAREGGDVIRSACKWSPELAAACEVWKEIKFEFDTIDKL
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggttccacaaacagaaactaaagcaggtgctggattcaaagccggtgtaaaagactac
cgtttaacatactacacacctgattacgtagtaagagatactgatattttagctgcattc
cgtatgactccacaactaggtgttccacctgaagaatgtggtgctgctgtagctgctgaa
tcttcaacaggtacatggactacagtatggactgacggtttaacaagtcttgaccgttac
aaaggtcgttgttacgatatcgaaccagttccgggtgaagacaaccaatacattgcttac
gtagcttacccaatcgacttattcgaagaaggttcagtaactaacatgttcacttctatt
gtaggtaacgtattcggtttcaaagctttacgtgctctacgtcttgaagaccttcgtatt
ccacctgcttacgttaaaacattcgtaggtcctccacacggtattcaggtagaacgtgac
aaattaaacaaatatggtcgtggtcttttaggttgtacaatcaaacctaaattaggtctt
tcagctaaaaactacggtcgtgcagtttatgaatgtttacgtggtggtcttgactttact
aaagacgacgaaaacgtaaactcacaaccattcatgcgttggcgtgaccgtttccttttc
gttgctgaagctatttacaaagctcaagcagaaacaggtgaagttaaaggtcactactta
aacgctactgctggtacttgtgaagaaatgatgaaacgtgcagtatgtgctaaagaatta
ggtgtacctattattatgcacgactacttaacaggtggtttcacagctaacacttcatta
gctatctactgtcgtgacaacggtcttcttctacacatccaccgtgctatgcacgcggtt
attgaccgtcaacgtaaccacggtattcacttccgtgttcttgctaaagctcttcgtatg
tctggtggtgaccaccttcactctggtactgttgtaggtaaactagaaggtgaacgtgaa
gttactctaggtttcgtagacttaatgcgtgatgactacgttgaaaaagaccgtagccgt
ggtatttacttcactcaagactggtgttcaatgccaggtgttatgccagttgcttcaggc
ggtattcacgtatggcacatgccagctttagttgaaatcttcggtgatgacgcatgtctt
cagttcggtggtggtactctaggtcacccttggggtaacgctccaggtgctgcagctaac
cgtgtagctcttgaagcttgtactcaagctcgtaacgaaggtcgtgaccttgctcgtgaa
ggtggcgacgtaattcgttcagcttgtaaatggtctccagaacttgctgctgcatgtgaa
gtttggaaagaaattaaattcgaatttgatactattgacaaactttaa

DBGET integrated database retrieval system