KEGG   Crassostrea gigas (Pacific oyster): 105320558Help
Entry
105320558         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105320558
  KO
K09435  transcriptional regulator ERG
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:crg03000]
    105320558
Transcription factors [BR:crg03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    105320558
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ets
Motif
Other DBs
NCBI-GeneID: 105320558
NCBI-ProteinID: XP_011416837
UniProt: K1QVN7
LinkDB All DBs
Position
Unknown
AA seq 430 aa AA seqDB search
MLTSETSDSFFADFPDFGQEDIITQVFGHDQSVPDLENIVPTLDVNCVPNFYQDWDTKEK
QPQLSPPQQQQQLQTQFLPPSYEEHIQTIENNNTLESLLAQPIKPAAAAAVPCRRLSEIL
ECINEDKDYRIITEDRLSPITPPPSVPVKETNYKQEKSQESKQFEETLKRIASLLSCGGQ
IKLWQFLLELLSEEENKDCIRWEGTSGEFRMVDPDAVARKWGQRKNKPSMNYDNMSRALR
FYYDKFILNKVSGKRHTYKFNFNAIINSMQSSTSSSHFNSSLMGLINNLTPNVTCPYQYP
GSFPSRHPSRYRQTRHFTTPPPPNYTVPCTKEEFPSSCRFASNKQFPSTSQINENMYSSC
QFDQRLYNDNTYSQDHPKQQVPFQTSCSVQSNGYSRSFEDNCMKTRRDYYRYSPYQRSPQ
NSTCVPMVGY
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgttgaccagtgaaacctccgacagttttttcgccgattttcccgacttcggccaagaa
gacattataactcaagtttttggacacgatcagtctgttcctgatttagaaaacatcgtt
cccactttggacgtgaactgtgttccaaatttctatcaggactgggataccaaagaaaaa
caacctcaactttctccaccacaacaacagcaacaactccagactcagtttttacctcct
tcgtatgaagagcacattcagacgattgagaacaataacactttggaaagcctgctcgct
caacccataaaacccgccgctgctgctgctgtaccatgcagacgactgagtgaaattctt
gagtgtattaacgaagacaaggattatcgtatcattaccgaagatcgcctatctcccata
accccaccaccttctgtaccagtaaaagaaaccaactacaaacaagaaaaatcgcaggaa
tcgaaacagtttgaagaaaccctgaaaaggattgcatcacttctttcatgcggtggtcaa
atcaaactgtggcaattccttctggaacttctctctgaggaagaaaataaagattgcatt
cgctgggaaggaaccagtggagaattccgaatggtagaccctgatgcagtggctcggaaa
tggggccagaggaaaaacaagccctccatgaattatgacaacatgagtcgtgctcttcga
ttctattatgacaaatttatcctcaacaaagtgtctggaaagaggcatacgtataagttt
aacttcaacgccatcatcaactctatgcaatcttctacatcgtccagccacttcaattcc
tctctaatgggacttatcaataacctcacgccaaatgtgacgtgtccctaccagtatccc
ggatcttttccttcccgccatccctccagatacagacagacccgccacttcaccactccc
ccaccgccaaactacacagtgccctgcaccaaggaagagttcccatccagttgtcgcttt
gcttcaaacaaacagtttccatctactagtcagataaacgagaatatgtattccagctgc
cagtttgaccagagactttataatgataatacttactctcaagatcacccaaaacagcag
gtgccctttcagacctcatgtagtgtccaaagcaatggatactcaaggtcatttgaagac
aattgcatgaaaacgagacgagattactatagatattccccttaccaacgatcgccccaa
aattccacgtgtgtgcctatggtagggtactag

DBGET integrated database retrieval system