KEGG   Crassostrea gigas (Pacific oyster): 105326408Help
Entry
105326408         CDS       T03920                                 

Definition
(RefSeq) glutathione S-transferase omega-1
Organism
crg  Crassostrea gigas (Pacific oyster)
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C_3 Glutaredoxin GST_C
Motif
Other DBs
NCBI-GeneID: 105326408
NCBI-ProteinID: XP_011424720
UniProt: K1Q2U0
LinkDB All DBs
Position
Unknown
AA seq 239 aa AA seqDB search
MSTEALSSGSTFPPLKAGTLRIYSNRICPYAERARLVLAHKDIPNEVVNIHLSKKPEWFL
EKINPLGKVPAIQKDDKIVYESAVCCDYLDQVYPSNKLTPDDPYQQARDRILVEHFGQVT
TQYYKMLFGPSENCAAAAETLKKGLMEFDKEIQKRGDFFGGSEPRMIDFMVWPWFERFHA
TEKLVNQIFISDGSMPNLTAYMDRMLSVPAVQKCRLSTENHLEFYQSVKNGAPNYNVGL
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgtctacagaagctttatcttccggctcgactttccctcccctaaaagcgggtaccctc
cgaatttatagcaaccgaatctgtccctatgccgagagagctcgacttgttttagcacac
aaagacattccgaatgaagtggttaatattcacctttccaaaaaaccggaatggtttctg
gagaaaataaatcctctgggaaaagttcccgctattcagaaggacgataaaattgtctac
gagtctgcagtgtgttgtgattatctggaccaggtatatccgagcaacaagctgaccccc
gatgacccttaccagcaggcaagagatagaatattggtggaacattttggacaggttacc
acacagtactataagatgctgtttggtccatcagaaaattgtgcagcggcagcggaaacc
ttgaaaaaagggctaatggaatttgacaaagaaatacaaaaaagaggggatttctttgga
ggaagcgaacctcgtatgatagatttcatggtatggccttggtttgagcgatttcatgcg
acggaaaagttggtgaatcaaatatttatatctgatggatcaatgccgaacctgactgct
tacatggataggatgttatctgttcctgctgtacagaaatgtcgtcttagtacagaaaac
catcttgaattttaccagagtgtgaaaaatggcgcacctaactataacgttggactgtag

DBGET integrated database retrieval system