KEGG   Crassostrea gigas (Pacific oyster): 105326575Help
Entry
105326575         CDS       T03920                                 

Definition
(RefSeq) peptidase inhibitor 15-A
  KO
K20412  peptidase inhibitor 16
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:crg04090]
    105326575
CD molecules [BR:crg04090]
 Proteins
  105326575
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CAP Kringle
Motif
Other DBs
NCBI-GeneID: 105326575
NCBI-ProteinID: XP_011425004
LinkDB All DBs
Position
Unknown
AA seq 343 aa AA seqDB search
MGRAILLISISLYVANAANFFDFIKNEVDTEISNIPIDRNFAGLSKRHTPHNGRQKKNSE
MQLDLNNLSIRGEEEPKTSTSVPEMAAMPNDFANRRTMRSLNSEQEQEVVDAHNAARLRA
SSSNMMKMRYNKVLAAQAQAHADSCVEAHSGLASENMFFSSANTINMSQAVHNWEIEKYD
YDYDTNTCKEGRACGHYTQVVWASSDEVGCGASNKCGGDYKTHIVCQYLPSGNYAGVRPF
KTGAPCSDCTACGHSCENGLCTRETSQCTDCYTGTGESYEGKYNTTLSGIPCQNWKSKFD
FLDDHNYCRNMFSSSGFTKPLCYVSPTPGNYVVEYCNVPMCGQ
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgctattcttctgatttctatttcattgtatgttgcaaatgctgcaaatttt
tttgattttataaaaaatgaggtagacaccgagatttcaaacattccgatagacagaaac
tttgcggggttatctaagagacacactcctcataatggaaggcagaaaaagaattcagag
atgcagctagatctaaacaatttgtcgatcagaggagaagaggaaccaaagacctcgaca
tctgttccggaaatggcggcgatgccaaatgactttgcaaacagaaggacaatgcgcagt
ctaaactcagaacaggaacaggaagttgtagatgcgcacaacgccgcccggctcagagct
tccagctcaaacatgatgaaaatgcggtacaacaaggtgcttgccgcccaagcccaggca
catgccgactcttgtgtagaggcacactcaggactggccagcgaaaacatgttcttttca
tcggcaaatacaatcaatatgtcgcaagcggtacataactgggaaattgagaaatatgac
tatgattacgacacaaatacttgcaaagaaggaagggcatgtggccattatacgcaggtt
gtatgggcgagtagcgatgaagtaggttgtggtgcctcgaacaaatgtggaggcgattac
aaaactcacattgtatgccagtaccttccaagtgggaactatgccggcgtacgtccgttt
aagacaggtgccccctgcagtgattgtacagcgtgtggacactcctgtgaaaatggacta
tgtacaagggaaacatcacaatgcactgattgttacacggggactggtgagtcttacgag
gggaaatacaacactactttgagtggaataccttgtcaaaactggaaaagcaagtttgat
ttcctagacgaccacaactactgcagaaacatgtttagtagttctggattcacgaaacct
ctctgttacgttagtcccactccagggaactacgttgtagaatattgcaatgttcccatg
tgtggacagtaa

DBGET integrated database retrieval system