KEGG   Crassostrea gigas (Pacific oyster): 105327128Help
Entry
105327128         CDS       T03920                                 

Definition
(RefSeq) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00440  Phosphonate and phosphinate metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    105327128
Enzymes [BR:crg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     105327128
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEP_mutase ICL
Motif
Other DBs
NCBI-GeneID: 105327128
NCBI-ProteinID: XP_011425742
UniProt: K1RHB3
LinkDB All DBs
Position
Unknown
AA seq 326 aa AA seqDB search
MVLGCVLRSALRNGCKVRVENMVYPGVRKMSSQSKPKKTTQLKNMLNSKELEFIMEAHNG
LSARIVEEAGFKGIWGSGLSISAQLGVRDSNEASWTQVVDVMEFMSDATSIPILLDADTG
YGNFNNARRLVRKLEDRGVAGACLEDKLFPKTNSLHDGRAQPLADIEEFALKIKACKDTQ
TDPDFCIVARVEAFIAGWGLDEALKRAEAYRNAGADAILMHSKKSDPSDIEAFMKAWNNQ
GPVVIVPTKYYKTPTQYFRDLGVSMVIWANHNLRSSITAMQGTTATIFKEQSLTSIEQNV
ATVKEVFRLQRDDELVSAEDQYLPKN
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggttctaggttgtgttttacgatctgcgttaagaaatggctgcaaggttcgagtggag
aacatggtgtacccaggggtccgtaaaatgtcaagtcaatcaaaaccaaagaaaacaaca
caattaaagaacatgttaaactccaaagagctggaattcatcatggaagcccacaacgga
ctgagcgccaggatcgtggaagaagccggtttcaagggcatctggggaagtggtttgtct
atatcagctcagctaggtgtacgagatagcaatgaggcttcatggacgcaggttgtcgac
gtcatggaattcatgagtgacgcaacatcaatccctattttactagacgccgacaccgga
tatggaaattttaacaacgcgcgcaggctggtgcggaaattagaggacagaggtgtagca
ggtgcgtgtttagaagacaaattatttcctaaaacaaattcactgcatgatggacgggca
cagccgttagcggatatcgaagaattcgcattaaaaataaaggcatgtaaagacacccag
accgatcctgacttttgcatcgttgcccgtgtagaggcgttcattgctggctggggattg
gacgaagctttgaagcgagccgaagcataccggaatgcaggcgctgatgccatcttaatg
catagcaagaaaagtgatccttcggacattgaggctttcatgaaggcctggaataatcag
ggaccagtagttatagtgcctacaaagtactacaaaactcccactcagtacttccgtgat
ttgggagtttccatggtgatatgggccaatcataatctacgttcttccatcacagctatg
cagggaaccacggcaaccattttcaaagaacaatccctcacatctatagagcagaatgtt
gccacggtgaaagaggttttccgtctacagagagacgatgagctggtgtcggcagaagat
cagtatttacctaaaaactag

DBGET integrated database retrieval system