KEGG   Crassostrea gigas (Pacific oyster): 105327683Help
Entry
105327683         CDS       T03920                                 

Definition
(RefSeq) alpha-aminoadipic semialdehyde dehydrogenase
  KO
K14085  aldehyde dehydrogenase family 7 member A1 [EC:1.2.1.31 1.2.1.8 1.2.1.3]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00010  Glycolysis / Gluconeogenesis
crg00053  Ascorbate and aldarate metabolism
crg00071  Fatty acid degradation
crg00260  Glycine, serine and threonine metabolism
crg00280  Valine, leucine and isoleucine degradation
crg00310  Lysine degradation
crg00330  Arginine and proline metabolism
crg00340  Histidine metabolism
crg00380  Tryptophan metabolism
crg00410  beta-Alanine metabolism
crg00561  Glycerolipid metabolism
crg00620  Pyruvate metabolism
crg01100  Metabolic pathways
Module
crg_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
crg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105327683
   00053 Ascorbate and aldarate metabolism
    105327683
   00620 Pyruvate metabolism
    105327683
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105327683
   00561 Glycerolipid metabolism
    105327683
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    105327683
   00280 Valine, leucine and isoleucine degradation
    105327683
   00310 Lysine degradation
    105327683
   00330 Arginine and proline metabolism
    105327683
   00340 Histidine metabolism
    105327683
   00380 Tryptophan metabolism
    105327683
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105327683
Enzymes [BR:crg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105327683
    1.2.1.8  betaine-aldehyde dehydrogenase
     105327683
    1.2.1.31  L-aminoadipate-semialdehyde dehydrogenase
     105327683
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 105327683
NCBI-ProteinID: XP_011426588
LinkDB All DBs
Position
Unknown
AA seq 538 aa AA seqDB search
MATVTILRRAQLLITRSTFASHKITRAMSSMLIDDPKYSWLKDLGLGPTNKGVFYGAWDG
TGEEVTSFCPANNQPIAKVTQASPADYEKAVVAAKEAWETWTEVTAPQRGEILRQMGEAL
RQKKTLLGKLESLEMGKILPEGEGEVQEYIDIIDYAVGLSRMFAGHVFPSERKGHMLLEQ
WNPLGLVGVITAFNFPVAVYGWNSSIAMACGNCVLWKGAPTTPLVSVAVTKILETVLKAN
NIPPAVCSLVQGGADIGTLMAKDERINLVSFTGSTPVGKKVSLMVQERFGKFLLELGGNN
AIIVNEDADLDMVVRAGVFACAGTAGQRCTTTRRLVLHEKVHDQVVAGLVKAYKQLRVGD
PLDDGTLYGPLHSQQGVDQYFAALEEAKAQGGKIECGGKKIDRPGNYVEPTIITGLKHDA
PIVLKETFVPIVYAVKFSNIDEAFKINNEVKQGLSSSLFTKDMNAVFRWMGPKGSDCGIV
NVNIPTNGAEIGGAFGGEKQTGGGRESGSDAWKQYMRRSTCTINYSAELPLAQGIKFE
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtgacaattttacgacgtgcacagcttctaatcactagatccacgtttgca
tctcacaagataacgcgagcaatgtccagtatgctcatagacgatcccaagtattcctgg
ttaaaggaccttggattaggacccacgaataaaggagtattttatggagcctgggatgga
actggcgaggaggtaacttcattttgccccgcaaacaatcaaccaatcgctaaagtgaca
caggccagtccagctgattacgagaaagctgttgtagctgccaaggaagcatgggaaacc
tggacagaggtgactgccccacaaagaggagaaatcttaagacaaatgggggaggcccta
aggcaaaagaaaacacttctgggaaagctggaatccttggagatgggcaagattttgccc
gagggtgagggagaagtgcaggagtacattgacatcattgattatgcggtggggctgtcc
aggatgtttgctggtcatgttttcccctcagaaagaaaaggtcacatgctgttggagcag
tggaatccccttggacttgtgggagttatcacagcatttaatttcccagtcgcagtgtat
ggctggaactcatccatcgccatggcttgtggaaactgtgtactgtggaaaggtgccccc
accactccactcgttagtgttgcagtcacaaaaattttggagacagtattaaaggccaac
aacattcccccagcagtttgttcacttgtccaaggaggggcagacattggaacattgatg
gctaaagatgagagaatcaatcttgtatctttcactggaagtaccccagttggtaaaaaa
gtatcattgatggtccaagagcgatttggcaaatttttgctggaacttggagggaacaat
gccattattgtgaatgaagatgctgatttggacatggttgtgcgggccggagtgttcgcc
tgtgctggtaccgccggacagaggtgtaccaccactaggagactggttttacatgagaag
gtccatgatcaggttgtagctgggttggtgaaggcctacaaacaactccgggtcggagac
cccctagatgatggaaccctgtatggtccactacacagtcagcaaggggtggatcagtac
ttcgcagcattagaggaggccaaggcccagggaggaaagattgaatgtggaggaaagaaa
attgacagaccaggaaattatgtggagcctaccataattaccggtctaaagcatgatgcc
cccattgtcctgaaagagacctttgtacccatagtgtatgctgtcaaattctcaaacata
gatgaggccttcaagatcaacaatgaggtaaagcagggcttgtccagcagtctgttcaca
aaggacatgaatgccgtgttcagatggatgggccctaaaggatcagattgtggcattgtg
aatgtcaacattcccacaaatggtgcagaaatcggaggagcgtttggtggtgagaagcag
actgggggtggaagagagtcgggcagtgacgcgtggaaacagtacatgaggagatctacc
tgcacaatcaactacagtgctgagttgccattagcccagggaatcaagtttgaatga

DBGET integrated database retrieval system