KEGG   Crassostrea gigas (Pacific oyster): 105328336Help
Entry
105328336         CDS       T03920                                 

Definition
(RefSeq) lysosomal alpha-glucosidase
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00052  Galactose metabolism
crg00500  Starch and sucrose metabolism
crg01100  Metabolic pathways
crg04142  Lysosome
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105328336
   00500 Starch and sucrose metabolism
    105328336
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    105328336
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:crg04147]
    105328336
Enzymes [BR:crg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105328336
Exosome [BR:crg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   105328336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil
Motif
Other DBs
NCBI-GeneID: 105328336
NCBI-ProteinID: XP_011427449
LinkDB All DBs
Position
Unknown
AA seq 955 aa AA seqDB search
MGSKNVVLTSFVLFLTLVTLALIYSLYAVPRVQIIIIQTQDGAFKEQNDGIRYQLNEKTG
KQEELKATKEEYEKKKNVQSKSQCAVVDDDNKFDCYPETSIATKEKCEARGCCWQAANQT
QTQSKGLNGKVTGVPFCYYPKDFSGYKTGLKATTPTGFTVALSRNTTGFYPDDVMNLVMD
IKYETEYRLRIRIYDPKNARYEVPLDTPKVTKAAPIQRYSVIVSNTGDAFNFAVTRKMLE
PGQPVVLFNTSGAAPLIFADQFIQLSTFLPTKCLYGLGEHRGSLLHSMDWRRLTTWNRDQ
APHDADTGTNLYGHHPFYLMMEDGGRSHGFFLLNSNAKETALQPAPALTWRTIGGVLDLY
MFMGPSPSEVVQQYTEVIGRSFMPPYWSLGFHLCKYGYHSVNETMAVVKRMQEAKIPQDT
QWNDIDYMDQYKDFTIGTSKFGDQAGMVNTLHSMGMHYVMIVDPGISNKKSSSPYPPYDV
GTKMDIWIKDSKGVPLVGKVWPGDVVFPDFTNPKAYDYWTQMTKAFHDQVQFDGMWIDMN
ELSNFYDGSLTGCPGNKYDNPPYVPAVLGDQLKAKTICPSAQQNFSLTYNVHDLYGLTET
MATYQALKTARARRPFIISRSTFAGQGHYGGHWSGDNFARYEDMAVSIPEMLNMNMFGIS
MIGADICGFHDDTTEQLCQRWQQLGAFYPFSRNHNDLGKKPQDPAVFSDAMKNSTRTALS
VRYSLLPYLYTLFHKSNAMGETVARPLFFEFPEDTNTYIIDDQFLWGSALMITPVLTKDT
TALNTYFPACAWYDFYTGLKITGSGSRIKVNAPLSQINLYVRGGNILPMVEPAMTTTESR
KNNFRLLVALNETGQANGGLFWDDGETIGTHDSGVFNMIMFSAGKNFVSSEVMKAGYTGE
KMTLDKLTVYGMLVTPKSVTVNGKGAQFQYNSPVKTLTVSIPLVDLLKPFSVKWM
NT seq 2868 nt NT seq  +upstreamnt  +downstreamnt
atggggagcaaaaatgtggttttaactagctttgttctatttttaaccttggtgaccttg
gctttgatatacagcctgtatgctgtaccaagagtgcaaatcataataattcaaactcaa
gatggagcatttaaagaacaaaatgatggaatcagataccagctgaatgaaaagactggc
aagcaagaagaattgaaagctaccaaagaggaatatgaaaagaaaaagaatgtgcagtcc
aaaagtcagtgtgcagttgtagatgatgacaataaatttgattgctatccagagacgtca
attgcaactaaagaaaagtgtgaggcaagaggatgttgttggcaagctgctaatcaaaca
cagacacaaagcaaggggttaaatggcaaagttacaggtgtccctttctgttactatcca
aaggatttttcaggatataagacagggcttaaggcaaccactccaacaggatttactgtg
gctttaagcagaaacacaactgggttttatccagatgatgttatgaatttggttatggac
ataaaatatgagacagagtacagattaagaataagaatatatgatcctaagaacgccaga
tatgaagttcctctggatacacccaaagtgaccaaggcagccccaatacagagatattca
gtcattgtcagtaacacaggagatgcattcaactttgcagtgacaagaaaaatgttggaa
ccaggccaaccagttgttttgttcaacacctcaggagcggcacctctgatattcgctgat
caattcattcagttatctacctttctgccgactaagtgcctgtatggactaggggaacac
agaggcagtcttcttcactccatggactggagaagattgactacatggaaccgggatcaa
gcccctcatgatgctgatacaggcactaatctgtatgggcatcatccattttacctaatg
atggaagatggtggaagaagtcatggatttttcctcctgaacagcaatgccaaagagact
gcccttcagccagctccagccttgacctggagaacaattggaggtgtccttgacctttac
atgtttatggggcccagtccatcagaggtcgtccagcagtacactgaggtcataggtcgc
agcttcatgcctccgtactggagtctcggattccacctgtgtaaatatggctaccactct
gttaatgagacaatggcggtggtgaaaagaatgcaggaggctaaaataccccaggataca
cagtggaatgatatagactacatggatcaatataaagactttacaataggaacatcaaaa
ttcggagaccaggcggggatggtgaacactctacacagcatggggatgcattacgtcatg
attgtggatcctggaataagtaataagaagagttcttccccttaccctccctatgatgta
ggaaccaagatggacatctggatcaaagacagtaaaggagttccgctggttggcaaggtc
tggccaggagatgtagtgttccccgatttcaccaaccctaaggcctatgattactggaca
caaatgaccaaagctttccacgatcaagtccagtttgatggcatgtggattgatatgaat
gaactttccaacttctatgatggttccttgactggttgcccaggaaacaaatatgacaat
cctccatatgtaccagctgttcttggggatcaactgaaggccaagactatatgtccttca
gctcagcagaacttctccttgacctataatgtccatgacctgtatggactgacagaaacc
atggcaacataccaggctttgaagacagctagagccagacgacctttcattatttcacgc
tccacctttgctggtcaaggtcattatggaggtcattggtcaggggataactttgctcgt
tatgaggatatggctgtatctataccagaaatgctgaatatgaacatgtttggaatatct
atgattggtgctgacatttgtggtttccatgacgacactacagaacagctgtgtcaaaga
tggcagcagcttggggctttttatcctttctccagaaaccacaatgacctgggaaaaaag
ccccaggacccggcagtgttcagtgatgccatgaagaactcgaccagaacggccctcagt
gtcagatactctctgctgccctacctctacactctgttccacaagtctaacgccatgggg
gagacggtggctagacccctattctttgagtttcctgaggatactaacacctacattatt
gatgaccagttcttgtgggggtcagctctaatgatcacgcccgtactgaccaaggacaca
actgctttgaacacctacttcccagcctgtgcttggtacgacttttacactggattgaaa
ataacggggagtggatccaggataaaagtgaatgccccgttgagtcagatcaacttgtat
gttagaggaggaaacattctaccaatggtggaaccagcaatgaccacaacggaaagtcgc
aagaataacttccgacttcttgtggctctgaatgaaacagggcaggccaatggaggcttg
ttttgggatgatggagagactataggtacacatgacagcggggtcttcaacatgatcatg
ttctctgcaggcaagaactttgtgtcatctgaagtgatgaaggcagggtacacaggagag
aagatgactctggacaagttaactgtgtatggaatgctagtgacaccaaaatctgtcaca
gtcaacggcaaaggagctcagttccagtacaactcgccagttaagacattgacagttagt
atcccactggtggatctactgaagccattttctgtcaagtggatgtaa

DBGET integrated database retrieval system