KEGG   Crassostrea gigas (Pacific oyster): 105328796Help
Entry
105328796         CDS       T03920                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00052  Galactose metabolism
crg00500  Starch and sucrose metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105328796
   00500 Starch and sucrose metabolism
    105328796
Enzymes [BR:crg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     105328796
    3.2.1.20  alpha-glucosidase
     105328796
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110
Motif
Other DBs
NCBI-GeneID: 105328796
NCBI-ProteinID: XP_011428111
LinkDB All DBs
Position
Unknown
AA seq 2734 aa AA seqDB search
MAGNRCSKERVGITLLVIVVLACIITPIVYLVQQPDKRQDGPKTLPTPAPVPAIPAELHQ
RIDCLPEARGKFMKLTKEECERRNCVFVQEQSNQSCVYPDNSEYGYSVVQETITLSATRY
YLRKRGKSPFTSPDFKEPVVVVEERGDNLVRIKFEDNKSQRYNVPLSINTPAKKASDPKY
EFKIMDKDTFAFQLIRKSTGTVLLDTSVGGLSLTDQFLQFSTRLPSLNVFGFGENVHQSF
KHNMNYQQWPMFSRDQATGGIHHFNLYGVHPFYTCVEEDGNTHGVLLLNSNAQDYAFTPL
PMLTYRTIGGVLDFYVFLGPTPENVIQQYTQAVGRPFLPPYWSLGFQLCRYGYNSLQNMK
RAVERTRNASIPLDVQYADIDHMDERKDFTVDQVNFNGLKEYFDELRSQGMRTIIILDPA
LLRSDPTYEPYKKLSDVKGAVMWGTETGGERYKDPTGALLGYVWPSGQVVFPDFFKTATK
NLWKQLIRDHREQRLVMDGLWIDMNEPANFGTNEEKPWNYPPNEPTWSLHCPDSPLEDPP
YRTMAAFVHDETNKKKRLSEKTICMTSRHGDKNDLQHYNVHSLYGWSQTQPTLEAIREAS
KERGVVITRSTFPGSGKYGGHWLGDNDSSWLSMRNSIIGMLEFNLFGIPYIGADICGFNR
DTTEELCLRWMQLGSFYPYSRNHNGIGNIEQDPAALGERVSKASREALETRYQLLPYLYT
LFYYAHVHGNTVVRPLHHEFTNDKYTMEISEQFLWGSSLLVSPVLYEGAQSITYYLPAGL
WYNYYNGSSMQSTGKKYTENVNLESKIPLSIRGGSIIPQQTPSTTTAKSRKNPLSLIIAL
DSDGSAEGNLFWDDGVSIETIEKSEYLLVSMKVRQSTFTYNIEGGNPSSIKEGVVIDKME
IWGIQENVSLVLKDNSEQISSFKQEGNKLIIDNLSHSLSEEFEMKWMKGKFDDLQRIDCF
PERLGKYEKLTKEKCQSRSCVYDPTPSEAPDCYFPMTGYGYSVSGRVNNKDNGWIVPLKL
RGKTPFGAPIMDLHFEIESYGDDIFRFKIDVPSKNRYTVPLNMGITPHKPSSEPRYELKI
TNNETFSFQIIRRSSKAVIWDTSVGGLTFENQFLQIATKLPSRNVYGFGENVHSKFRHDL
NWKQWPMFARDEGTGQENFKNHYGVHPFYMCMEEDGQAHGILLLNSNAQDYAFTPLPMLI
YRTIGGILDFYVFMGPEPENVVQQYHKAIGRPYLPPYWSLGFQLCRYGYNSIAKMQEAVN
RTRKANIPHDVQYADIDHMYKQMDFTIDHDRFPDLNAYFQGLQQKGMKTIIILDPTLISN
VSGYEPYERIKAVRGSIMWPQNYSIPRDSSDNGAVLGYVWPEGKVIFPDFFKNATERVWE
ELIRSHHSNISFDGLWIDMNEPANFGTNEEKPWNWPDGAKPYWSLKCNEGEALEDPPYRT
MAAFVYDREDRKIRISDKTICMVAKQGNNGEYNHYDVHSLYGWSQSPSTLNGLRQATNKR
GIVISRSTFPGSGKYAGHWLGDNSAVWLDIHLSIIGSLEFNLFGIPYIGADICGFFGNSS
AQLCKRWMQLGAFYTFSRNHNGINYEPQDPAYFGEDVAEASRIALETRYSLLPYLYTLFY
KSHTKGGTVMRPLHHEFPRDKLTYDIDSQFLWGPALLISPILYENQNTLSFYLPSGDWYD
FYTGKHYIGGQRLIQEVDGDSKIGLHVRGGFILPQQTPALTTTESRTKPFTLLVALNYDG
RRRTASGDLYWDDGESIEPSNYFYSKFQYNNDILSMNIQKNNDQLVQNLTIDTVVILELP
DSFRYAYIQGNSLELAIEGGSMKMIKNLRISLQKDFALEFREEMKPLEDEASRIDCLPDI
TGDENQNKMLCRNRGCIWNRVENKNSVPACFINDTNHGYTFLNESSGYHSKTIHLQWKNK
SSIFGGDLRKIRLSIQELSENIVRLKFDDPSHNRYEVPVPINRNIKSHTPASQKYVIEYS
NSSSSTFYIKVIRKDTKKTIFDTSSGGFTFADKFLQLSTILPSSYVYGIGENRHFTFQHN
LNFKRWPMFSRDNGVNWGDYANLYGVHPFYMCVEDDDGNSNGVLLLNSNAMEVVFSPRPS
LTYRTVGGILDFYVFMGSSPENVIQEYTEVIGRPYLPPYWALGFQLSRYGYNTLDNLKSA
TKRMVDNNIPLDVQYADIDHMDERKDFTIDEVNFKNLSGYVKELQQQNMHFIIILDPALI
SNETNYYPYETGKGRMFIKWPILNNDTRSGQDMLGYVWPKGKVVFPDFLKNETREYWKDL
IVGHYTNLSFDGLWIDMNEPANFGTNEERPFNWPEKDKPYWSLKCPHSELDDPPYKPRGV
FGPRLSDKTLCMVALQNDGAYQHYDVHSLYGWSETEPTLYGLREATRGNKRGIVISRSTY
PSSGKYAGHWLGDNDSKWPDVHDSIIGLLEFNLFGIPYIGADICGFFGHPSAELCERWMQ
LGAFYTFSRNHNTINTKDQDPAIFGPANADSARRALNLRYSLLPYLYTLFYEVNSNGGTV
IRSMMQNFPKDIKSRNIDTQFMWGPAIMIAPVLSAGKIEADVYFPEGRWFDFTSGELISE
GDKKTVTVSAPRDKIPVFVREGYIIPTQSHGANTEVARKNPMDIIIIPDESGKAEGKLFL
DDGDTIDTVENGKFYLSSFKFNGTYFSMTITTHNETMVDSIRVGSMTIFGMKREITSVTV
NNANKLFEKLKPHNKLYIKDLGVTLQNNIEVVLK
NT seq 8205 nt NT seq  +upstreamnt  +downstreamnt
atggcaggaaatcgctgcagcaaagagagggtggggatcacgcttcttgtgattgttgtc
ctcgcctgtatcatcactccgatcgtctatctagttcaacagccggacaaacgacaggac
ggtcccaaaacccttcctacaccggcacctgtaccggccataccggccgagcttcaccaa
cgaatagactgtctacccgaggcgcggggaaaatttatgaaacttacgaaagaagaatgc
gagcgacggaactgcgtcttcgtacaggaacagtcgaaccagagttgtgtttacccggat
aattcggagtacggatattccgttgtacaagaaacgataaccctttctgcaacccggtac
tatctacggaaaagagggaagagtccttttacaagtccagatttcaaagagcccgtggtc
gtagtagaagaaaggggagataatcttgtcagaataaagtttgaagacaacaaatcccag
cgctacaacgttcccctgtcgatcaacacacccgcaaagaaagccagcgatccgaaatac
gaattcaaaatcatggacaaagacacatttgctttccaattaatcagaaagtccacaggc
actgtattattggacacgtcggttggcgggctttctcttactgaccagttcctccagttc
tcaacccgcctacccagcttaaatgtgttcgggttcggagaaaatgtccaccagtccttc
aaacacaatatgaattaccaacagtggcccatgttctcacgcgatcaagccactggtgga
attcaccatttcaacctgtatggggtccatccattttacacctgtgtagaggaagatggc
aatacgcatggagtccttctgctaaacagcaacgcgcaagattacgcgttcacgccactc
ccgatgctgacctacagaactataggcggagttctagatttttacgtctttctgggaccc
acgcctgaaaatgtcattcaacaatacacacaggcggtgggtcgcccatttctccctccc
tactggtccctgggcttccagctctgtcggtacggctataatagcctacagaatatgaag
agagcggtggagagaacaaggaacgctagtataccgttggatgttcaatacgccgatata
gaccacatggatgaacggaaagacttcactgttgaccaggtgaactttaatggactcaag
gagtactttgacgaactacgaagccaaggaatgcgaaccattatcatattggatcctgca
ttactgcgctcagacccaacctacgagccctacaaaaagctgagtgacgtgaagggggcc
gtgatgtggggaaccgagaccggaggcgagcggtacaaggatccaacgggggcgttactg
ggctatgtatggcccagcggacaagttgtgtttccggacttttttaagacggcgaccaag
aacctgtggaaacagctgatcagggatcatagggagcagcgactggtcatggacggtctt
tggatcgatatgaatgagccagctaattttggaaccaatgaggagaagccctggaattac
ccccctaacgaacctacctggagtcttcattgtccggattccccgctggaggatcctcct
tacagaaccatggcggcttttgtgcacgatgaaacaaacaagaagaagcgtctgtcggag
aagactatttgtatgacgtcacggcatggcgacaagaacgatctacagcattacaatgtc
cacagtctttatggatggagccagacccagcccactctggaggctattcgcgaagcgtct
aaagaacgcggcgtggtgatcacgaggtcaacgtttccaggaagcgggaaatacggaggt
cactggctgggtgacaatgacagctcctggctgtccatgaggaactctatcataggaatg
ttggaatttaatctttttggaataccatatattggtgcagacatttgcggctttaaccgc
gacaccacagaggagttgtgtctcagatggatgcagcttggatcattttatccgtactcc
cgaaaccacaatggaataggaaatattgagcaagatccagcagcccttggtgagcgcgtg
agcaaagcgtcacgtgaggcactggagacgcgttaccaactcttgccgtatttgtacacg
ttgttctattatgctcacgtgcacgggaacacagtggttcgacctcttcatcatgaattc
acaaacgataaatacactatggagatatctgaacaatttctatggggtagctctctactc
gtctcccctgttttgtatgagggtgcccaaagcatcacttattacttgcccgcaggatta
tggtacaattattataacggaagttcaatgcagagcactggtaaaaaatacacagagaat
gtaaacctagagtctaagatcccactgtccatcaggggcggatctatcatccctcaacaa
acgccttcaacaacaacagcgaaaagtcgaaagaatccattgtccttgataatagcactg
gacagcgatggaagtgcagaaggaaatttattttgggatgatggagtttctatagagacc
attgagaaaagtgaatatttgcttgtgtccatgaaagttagacagtcaacattcacttac
aacattgaaggagggaacccgtcatcaataaaagaaggagttgttattgataaaatggaa
atctggggaatccaagaaaacgtcagtctggttttaaaggacaacagtgaacagatatcc
agcttcaaacaagagggaaataaactgatcatagacaatttgtcccactccttgtcagaa
gaatttgaaatgaaatggatgaaagggaaattcgatgatcttcaaagaattgactgtttt
ccggaacgcttaggaaaatacgaaaaattaactaaagagaaatgccagagcaggagttgt
gtgtatgacccaaccccgtctgaggccccagattgttactttcctatgacagggtacgga
tacagtgtgtcaggacgtgtgaataacaaggataatggctggatagtacctttgaagttg
aggggaaagaccccgttcggagccccaatcatggatcttcacttcgagatcgaaagctat
ggagatgatattttccgttttaagattgacgtgccgtcaaagaacaggtacactgttcca
ttaaacatggggattactccacacaaacctagttcagaaccgagatacgaactgaagatc
accaataatgaaacattctctttccaaatcataagaagaagctctaaggctgtcatctgg
gatacgagtgtgggaggtttgacatttgaaaaccagtttctacaaatcgccacaaaacta
ccctctaggaatgtgtatggatttggcgagaatgtccacagcaaatttcgtcacgacttg
aattggaagcagtggcctatgtttgctcgagacgaggggacgggacaagagaattttaaa
aaccattatggagtccatccgttctacatgtgtatggaagaagatggccaggcccatggt
attttgctgttaaacagtaatgcacaagattacgctttcactcccctccctatgttaatc
tacagaactatcgggggcatacttgatttctatgtcttcatgggaccagaacctgaaaac
gtggtccaacaatatcataaggccataggaagaccatacttaccgccatactggtccttg
ggtttccaactgtgtcggtatggttacaacagtatagcaaagatgcaagaagcggtaaac
cgaacgaggaaggcaaacataccgcacgatgtgcagtatgcagacattgaccacatgtat
aaacagatggacttcaccatcgatcacgatagattccctgatttgaatgcctactttcaa
ggacttcagcaaaaaggaatgaaaacgattatcattttggatccaactttgataagcaac
gtgtctggctatgaaccttatgaaagaataaaggcagtccgaggaagcataatgtggcct
caaaattacagcattccccgtgacagcagtgataatggcgctgttctgggatatgtatgg
ccagaaggaaaggtcattttccccgatttcttcaagaacgccaccgaacgggtttgggag
gagctcatcaggtcccatcacagcaacataagttttgacggactttggattgacatgaac
gaaccagcgaactttggaacaaacgaagaaaaaccatggaactggcctgatggagctaaa
ccgtattggagtttgaaatgcaacgaaggcgaggctctggaggacccgccgtatcggacg
atggcggcttttgtatacgacagagaagacaggaagatacgaatatcggacaaaacgata
tgtatggtagcaaagcaaggaaataacggagagtacaaccactatgatgtccacagttta
tatgggtggagccaatctccttcgactctgaatggtctcagacaagctaccaacaaaaga
ggcattgtgatatcccgttcgacgtttcccggaagtggaaagtacgcagggcactggttg
ggtgataactccgctgtctggctagatattcatctctccattattggtagtctggagttc
aaccttttcggtataccttacattggagccgatatttgtggcttttttggaaactcttct
gcacaactttgcaagagatggatgcagttaggggcgttttacactttcagcagaaaccat
aatggaataaactatgagccccaagatccggcctattttggagaagacgttgcagaagca
tcacgcatagcattggaaacccgctactccttactcccgtacttgtataccttattttat
aaatctcacacaaaaggtgggaccgtcatgaggcctctccatcacgaattccctagagat
aaacttacttacgatatagattcacagtttctatggggtccagcactcttgatttcgcca
atcctgtatgagaaccaaaataccttatcgttctatctgccaagcggtgactggtacgat
ttttacactgggaaacactacattggaggacagaggctcatccaggaagtggacggggat
tctaaaattggcctgcatgtgagaggtggatttatcttgccacaacagacaccggctctc
accactactgagagtaggaccaaaccgtttacacttttggtggccttgaattacgatggg
cgacgacgaacggctagcggtgatttatactgggacgatggagaaagtatcgaaccttcc
aattatttttattccaagtttcaatacaacaatgatattctcagtatgaacattcagaag
aataatgaccaattggtccagaacttgacaatagacactgtcgttattctggagttacca
gatagttttagatatgcatacatacaaggaaacagtctggagttagccattgaaggtggt
tctatgaaaatgataaagaatttgcgaatttctcttcaaaaagactttgccctggagttc
agggaggaaatgaaaccgttagaagacgaagcttctagaattgactgcttaccagatatt
actggagatgaaaatcagaacaagatgctgtgcagaaacagaggttgcatatggaatagg
gtcgaaaataagaattccgtgcccgcatgttttataaatgacacaaatcatggctataca
ttccttaacgaatcatcaggatatcatagtaaaacaattcatcttcaatggaagaataaa
tcttccatttttggaggagatttacgaaagatacgactaagcattcaggaattgtcggaa
aatattgtccgtttgaaatttgacgatccttcacacaacagatatgaagttccagttcct
ataaacagaaacatcaagtctcacaccccggcgagtcagaaatatgtaatagagtactca
aatagtagcagttccactttctatattaaagtaataagaaaagataccaagaaaacaatt
ttcgacacttcgagtggaggtttcacctttgccgacaagttccttcaattatccacaatt
ctcccttcatcatacgtatacggcattggcgaaaaccgtcactttacgtttcagcacaat
ttaaatttcaaacggtggcccatgttttctcgtgacaatggcgtcaattggggtgattac
gccaacttgtatggcgttcatccattttacatgtgtgtggaggatgatgatggaaactcg
aatggcgtactgttgctgaatagtaacgccatggaggtggtgttcagtcctcggccgtct
cttacctatagaacggttggaggcattcttgatttttatgtcttcatgggatccagccca
gaaaatgtaattcaggagtacacagaggtaattggacgaccgtaccttccaccatattgg
gcattgggctttcagttaagtcgatatggttataacactttagacaacttgaagtcggca
acaaaaagaatggttgacaacaacattcctctagatgtacaatatgcggacatagatcac
atggatgaacggaaggacttcaccattgatgaagttaattttaaaaatttatcaggatat
gttaaagaacttcagcaacaaaatatgcatttcattatcattcttgatcccgctctgatt
agcaatgaaacaaattactatccttatgaaactggaaaaggaagaatgttcattaaatgg
cctattttaaataatgatacccgaagcggccaggacatgcttggatatgtttggcctaaa
ggaaaagttgttttcccagatttcctaaaaaatgaaacacgtgaatattggaaagattta
attgtcggacattatacaaatttgtcatttgatggattatggattgatatgaatgaacca
gcaaactttggaacaaacgaagaacgaccgtttaattggccagagaaggacaagccatat
tggtctctaaaatgtccacactctgaactggacgatcctccatacaaaccaagaggtgtg
ttcgggcctcgtttgtcagacaaaacactatgtatggtagccctacaaaacgatggcgcc
taccaacactatgatgtccatagtttgtatggttggagcgaaacagaaccaacactgtac
ggactgcgggaggctacgagaggaaacaaaagaggcattgttatatcccggtctacctat
ccatcaagtgggaaatacgctggtcactggctaggtgataacgacagtaaatggcctgat
gtgcacgactccatcatcggactcctggaattcaacctctttggtattccgtacatcgga
gccgacatctgcggattttttggacatccttctgcagaactctgtgaaagatggatgcag
cttggtgcattttacacattttctagaaatcacaatacaattaacacgaaagatcaggac
cctgcgatttttggtccagcaaatgctgactctgccagacgggctttaaacttgcggtat
tcgctcttgccttacctatacactttgttttacgaggttaactctaatggcggtacggtg
atccgatccatgatgcaaaatttcccaaaggacatcaagtcgcgcaacatcgatactcaa
ttcatgtggggaccggccattatgatcgctcccgttctcagcgcagggaaaattgaggcg
gatgtatattttccggagggtaggtggtttgacttcacatccggtgaacttatcagtgag
ggggataagaagacagtgaccgtgtccgctccgcgagacaaaattcctgtttttgttcga
gaaggttacatcattccaacccagtcacatggtgctaacaccgaagtcgcaagaaagaat
cccatggatataataatcattccggacgaaagcggaaaagcagaaggtaaactattcctg
gacgatggagatactatagataccgtggaaaatgggaagttctatttgtcgtcatttaaa
ttcaatggcacatatttttcaatgactattaccacccacaatgaaactatggttgacagc
attcgtgtgggaagtatgactatattcggcatgaagagagaaataactagtgttacagtt
aacaatgccaataaactcttcgagaaattaaaaccacataataaattgtatattaaagac
ttgggtgtcacactgcaaaataacattgaagtagttttaaaatga

DBGET integrated database retrieval system