KEGG   Crassostrea gigas (Pacific oyster): 105330510Help
Entry
105330510         CDS       T03920                                 

Definition
(RefSeq) proto-oncogene tyrosine-protein kinase receptor Ret-like
  KO
K05126  proto-oncogene tyrosine-protein kinase Ret [EC:2.7.10.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:crg01001]
    105330510
Enzymes [BR:crg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     105330510
Protein kinases [BR:crg01001]
 Receptor tyrosine kinases (RTK)
  RET family
   105330510
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Cadherin
Motif
Other DBs
NCBI-GeneID: 105330510
NCBI-ProteinID: XP_011430530
LinkDB All DBs
Position
Unknown
AA seq 1146 aa AA seqDB search
MVLHNSFKIQGWILLFYFRGVVGLYFTQESYVFSPADSVIGQVIALPSITSPPECHQSSV
GYRIRTVSDVAISLQVDQRGWILASPTYKGKGDFYFNVSAECGSGTKRERADVTVNVMNG
GTCELQNLSSANNSKLRSITKDLCFQKQIFNLYIEERKRNGVVGYLSKCVQNISGNGVQR
FYAIASDIFLIDNVTSEIRLLRDLDREQDTDMIKLDVKCDINFMKKDINYVNEGMINVHV
ADVNDNPPMFHNTLTQQINAGKLKEVEEVIVDKDTQDFSKHEIKVLEGQEFCHPLPMYCF
KVKPEKTICNCFHIVCRLEVNITRPENEKNDIDHKCLVQVRDPAMLLMSDNPNNAANLTI
IIPSEKSRVPVRESPDIFYATISRMASRLAKVIEFPNPDKGAFALSKGSNDAFDVTFSSG
IVYVNDVTKLRKLNSQVNLTIEHTFHRLTLVLNIEGPYVPVDDYLCNVTCASYMDEMSCN
KGCGVGSGNGKCRWRSGDERGYSRKFSTCVSDLTTCTDHMCDDRESLDILICPQDCTTAT
IRGEGFLNTNYNPARGIDSGTSPCWCNYAGECSCFRPSSFSKVIPTSHITSKVEKKPPVR
VRNPETTTGRLDFSDYPFTPKVSSSTAQSQSNSGIGCDWHCRTTIAAVTGCVGALICVIV
LTWRLRRLHCHAGQPLKHVGSAASISGVPSEYHEDYRIPHTSPQWSPKRSPDYNMASEDH
KWEFPRDKLKLDETIGEGEFGRVAKAKAFGMDGPEGYKCVAVKMLKNCDSNGELQDLLSE
YNLLKDIDHPNVIKLLGACTRNGPFYVIVEYCEHGSLLQYLRNSRLEENGYINHRCRRYF
RSQSESGNSTEPELLNIRDLLSFAWQISKGMQYLSEIKLVHRDLAARNVLVGTGKVLKIS
DFGLTRDVYEADTYLKRSKGRIPVKWLAPESLYAQVYTTQSDVWSFGIVLWEIVTLGKTS
NAKRKFEMSITGTLLIAGYRMDRPEGCSDELYAVMQKCWKADPTDRPVFASLTGIFDGML
QQRTEYLELTGGFENVDTDLFDMCPDANAIYYAVDSRREPPISRERKEVGVVTKDQVGSG
DPYLTPASRSDVINQKCNELQCQSECSVQNDENVALLLECRTAVFSNSLESEDEDMPLKQ
PFQAVA
NT seq 3441 nt NT seq  +upstreamnt  +downstreamnt
atggttttacacaattcatttaaaattcaaggatggatacttcttttctattttcggggt
gtggttggcctatacttcactcaggagtcctacgtattcagcccggcggactcggtaata
ggacaggtaatagcactaccgagtattacctcacccccagaatgtcaccagtcctcggtg
gggtaccgtatccggaccgtcagtgacgtggctatctcgttacaagtcgatcaaagggga
tggatactagccagcccaacctataaagggaaaggcgacttctactttaatgtcagcgcg
gagtgtggctccggaaccaaacgggaacgtgctgacgtcacagttaacgtaatgaatggc
ggtacatgtgaactgcaaaatctgtcgtctgcaaacaattccaaactccgaagcataacc
aaagatttgtgttttcaaaagcaaattttcaacttgtatatcgaggagagaaaaagaaat
ggggtcgtcggctacttgtcgaaatgtgttcagaatatttctgggaacggagttcaaaga
ttttatgccattgcttcagatatctttctcatcgacaatgtgacatcggaaattcgtcta
ctccgagatttagaccgggaacaggatacagacatgatcaaacttgatgtcaaatgtgac
attaactttatgaagaaagacatcaactatgtgaatgagggcatgataaacgtacacgtg
gcagacgttaacgataacccgccaatgtttcacaacacgttgacacagcagataaacgcg
ggaaaattgaaagaagtagaagaggttattgtcgataaagatacccaggatttttccaaa
catgaaatcaaagttctggaaggtcaggaattctgtcaccccctccccatgtactgcttc
aaagtgaaacccgagaaaaccatctgtaattgtttccacatcgtctgtcgacttgaagtc
aatattacccgcccagaaaacgagaaaaacgacattgatcacaaatgtttagtgcaagtg
cgtgatccagccatgcttcttatgtcggacaatcctaacaacgcagccaatctgactatt
attattccatcagagaaatctcgtgtaccagtgagggaatctccagacatattttacgcc
acgatatcaagaatggcttcaagacttgcaaaggtcattgaatttccaaatcccgataaa
ggggcattcgctttgtccaaaggttccaatgacgcttttgatgtgacgttctcttccgga
atagtttatgtcaatgacgtcacaaagttacggaagttaaactctcaggtgaacttgaca
attgagcacacgtttcaccggctcactcttgttttgaatatcgagggaccgtatgtacct
gtcgacgactatctctgcaatgttacttgtgcaagttacatggacgaaatgtcttgtaac
aagggttgtggggtcggttccggaaacgggaaatgtcgttggcgatccggggacgaaagg
gggtattcccggaagttttccacttgcgtctctgacctgactacgtgtacagaccacatg
tgtgatgaccgagagtctctcgatatcctcatctgtccgcaggactgcacaacagctaca
ataagaggggaggggtttttgaacactaactacaaccctgctcggggcattgactcgggg
accagtccttgttggtgtaactatgccggggagtgttcctgtttcagaccttcgtctttc
tcaaaagtgattcctacatcccacattacgtcaaaggtggagaagaagcccccagtcaga
gtcaggaacccagaaactacgactggaagactggatttctccgactacccgtttacacca
aaagtctcttcctctacagcccagtctcagagtaactcgggtatagggtgcgactggcac
tgccgcacaaccattgccgctgtcacaggctgtgtcggcgccctcatctgcgtcatagtc
ttaacatggcgattgcgtcggctccattgtcacgcgggtcaacctctcaaacacgtgggc
agtgctgcgtctatttccggtgtcccttcggaataccatgaggattatcggattccacac
acatccccgcaatggtccccaaaacgatcaccagattataatatggccagtgaggatcac
aaatgggaatttcctcgtgacaaattgaaactggacgagaccataggggagggggagttt
gggcgcgttgcgaaggccaaagcgttcggaatggacggtccagagggctacaagtgcgtg
gctgtcaagatgctgaaaaactgtgattcaaacggtgaattacaggatttattatcggag
tacaaccttcttaaggacattgaccacccgaatgtcatcaagctgctaggcgcatgcacc
agaaatggtcccttctatgtgatagtggagtactgcgagcacggctccctgctgcagtat
ttaaggaactcgaggctggaggagaacggctacattaatcaccgttgcagacgatacttc
aggtcgcagtcagagagcgggaactccacggagccagagctcctgaacattagagacctg
ttgtcgtttgcttggcaaatctcaaaaggaatgcaatatctcagtgaaatcaagcttgta
catcgggatcttgctgcaagaaacgttttagttggtaccggcaaggttctgaagatatcc
gatttcggtcttaccagagatgtatacgaagcagacacatatctcaaaaggagtaaaggt
agaattccagtgaaatggttagcaccagaatcgttatatgcccaggtgtacacaactcaa
agtgacgtgtggtcgtttggtattgtactgtgggagattgtaacactaggtaagacctcg
aatgccaaaagaaagtttgagatgtcaataacaggcaccctgctgatagcggggtatcgg
atggaccggccggagggctgctccgatgaactgtatgcagtgatgcagaaatgttggaaa
gcagatccaacggacaggccagtattcgctagtctaacaggaatcttcgatggaatgctt
caacagagaactgaatatttggagcttaccggaggatttgagaatgttgatacagatctc
tttgacatgtgcccagatgccaatgctatttattatgcagttgacagtcgacgagagcca
cctatttccagggagaggaaggaagtgggagtggtaacaaaggaccaggtgggcagtgga
gacccttatctgacgccggcatcccggagtgacgtcatcaaccagaagtgcaatgaactc
cagtgtcagtcggagtgtagtgttcaaaatgatgagaatgtcgcattactgctagaatgt
cgaacggcggtgttctcaaattcgttagagagtgaagacgaagacatgcccctcaagcaa
cctttccaagccgtcgcgtaa

DBGET integrated database retrieval system