KEGG   Crassostrea gigas (Pacific oyster): 105330981Help
Entry
105330981         CDS       T03920                                 

Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00480  Glutathione metabolism
crg00980  Metabolism of xenobiotics by cytochrome P450
crg00982  Drug metabolism - cytochrome P450
crg00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:crg00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    105330981
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105330981
   00982 Drug metabolism - cytochrome P450
    105330981
   00983 Drug metabolism - other enzymes
    105330981
Enzymes [BR:crg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105330981
Transporters [BR:crg02000]
 Other Transporters
  Pores ion channels [TC:1]
   105330981
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 105330981
NCBI-ProteinID: XP_011431267
UniProt: K1PPS9
LinkDB All DBs
Position
Unknown
AA seq 153 aa AA seqDB search
MPVELRDVALLGGVSVMHAWQLAKFARRVGAARGKFKVNYPAISGNEEFERYYRAQMNTL
EFFPIFSTSLWMSGLFFHQVPAAIAGVVYIYARNKYFNGYIVSVKDRIPGFKLGVNCIMA
MLGMFLLGIGHLAVETFTGINIKEQYLQQYLKF
NT seq 462 nt NT seq  +upstreamnt  +downstreamnt
atgccggtggaactgagggacgttgctcttttggggggtgtaagtgtaatgcacgcttgg
cagctggctaaatttgccagaagagttggtgctgctcggggaaagtttaaggtgaactat
ccagcaatcagtggcaatgaagaattcgaacgctactacagagctcaaatgaacaccctt
gaattctttcccatcttttcaacatctctgtggatgagtggactgtttttccatcaagtt
cctgctgctattgctggggttgtgtatatatatgccagaaataaatacttcaatggctac
atagtcagcgtcaaagatagaataccaggatttaagcttggagtgaattgcatcatggct
atgttaggaatgttccttctgggtattggacatcttgccgtggagaccttcactgggatc
aacatcaaagaacaatacctccagcagtacctcaagttctga

DBGET integrated database retrieval system