KEGG   Crassostrea gigas (Pacific oyster): 105332371Help
Entry
105332371         CDS       T03920                                 

Definition
(RefSeq) TNF receptor-associated factor 2
  KO
K03173  TNF receptor-associated factor 2 [EC:2.3.2.27]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:crg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    105332371
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:crg03019]
    105332371
   04121 Ubiquitin system [BR:crg04121]
    105332371
Enzymes [BR:crg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     105332371
Messenger RNA biogenesis [BR:crg03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     105332371
Ubiquitin system [BR:crg04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   TRAF proteins
    105332371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TRAF_BIRC3_bd zf-TRAF zf-C3HC4_4 zf-C3HC4 Phage_prot_Gp6 PAS_10 AAA_13 zf-C3HC4_2 zf-RING_UBOX ALIX_LYPXL_bnd DUF16 DUF3450 DUF5082 Spc29 Macoilin Spc7
Motif
Other DBs
NCBI-GeneID: 105332371
NCBI-ProteinID: XP_011433247
LinkDB All DBs
Position
Unknown
AA seq 536 aa AA seqDB search
MASQQVVGGYNVEIFMGENFDRKFLCNHCSLILRDPVQSYCGHRFCRSCMESIIRSHEQV
RCQSCIEEGTMDEEYSILKMDQMFPDNAVRREMGAMAAKCINPNCTWKGIFKQYEAHVAE
CKFKQVPCQLCGNLIEPQVLQDHMTKECTKRKIACKHCQSEVVVENLEAHNAECPKMPIK
CDSCGKKKIPRDKMQHHIDKECSNQKVPCLTDCGDISRDKFVEHLDKRPGIHLKALVEEL
NSFRNDINSRLEAVVVQTDLGQFISHITELKQKVQQHEQLIQTLQGHQAANGTPANSNPS
VIQAKVQALELKTGTFEGIVTTLHREIERCITAIENVERGRQGEKQVVDSLEKKIRALER
SISLKDVALAEQELRIKTLELTTYDGTLFWKISEWSKRRSEAQSNQVTSLYSPIFYSSKN
GYKMCARLYPNGDGMGKNTHMSIFFVVMRGNFDALLQWPFSYRVTFMLLDQNNKEHQVDS
FRPDPNSSSFKRPTTEMNIASGCPLFIPLAKLDDPSLAYVKEDTMFIKLVVDVPRG
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcacaacaagttgtaggaggctacaatgtagagatatttatgggggaaaatttt
gacagaaaatttctgtgtaaccactgtagtttgattttgagagaccctgtacaaagttat
tgtggtcacagattctgtcgatcatgtatggaaagcatcatcaggtcccatgaacaagtg
agatgtcagtcctgtattgaagaagggacaatggatgaagagtacagtatactgaaaatg
gaccagatgttcccagacaacgcagtcagaagagaaatgggagccatggctgctaagtgc
atcaatcctaactgtacatggaaaggaatcttcaaacagtatgaagctcatgtggcagag
tgtaaatttaagcaagttccctgtcaactgtgtggtaacttgattgaaccacaggtcctc
caagatcacatgaccaaggaatgtacaaaaagaaaaattgcctgcaagcactgtcagtca
gaggtggtagttgagaacctggaggcacataatgcagaatgtcccaaaatgcccatcaaa
tgtgactcttgtggcaagaaaaaaatacccagagacaagatgcaacatcacatagacaaa
gagtgttctaatcagaaggtcccctgcctcacagactgtggtgatatcagcagagataag
tttgtggagcatctggataaacgtcctggaatccacttaaaagctttagtggaggagtta
aactctttccgtaatgatataaactcaaggcttgaagcagttgttgttcaaactgacctt
ggacagtttatttcacacatcactgaactcaaacaaaaagttcagcaacatgagcagctg
attcaaactctacaaggtcatcaagcagccaatggcacaccagcaaattcaaatccaagt
gtgatacaggccaaagttcaggccttggagctgaagacaggtacctttgaaggcattgtt
acgacacttcacagagaaattgaacggtgtattactgcaattgagaatgttgagaggggc
aggcagggtgaaaagcaagtagtggatagtctagagaagaagatacgtgctctggagagg
agtatctcactgaaggatgtagctcttgctgaacaggaactgcgaataaagacgctggaa
ttgacgacttatgatggaacgctgttctggaagatttctgagtggagcaagcggcgatcg
gaggcacagagcaaccaagtgaccagtctctactcccccatcttctactccagcaagaat
ggctacaagatgtgtgccagactctaccccaatggagacggcatgggcaaaaacacgcac
atgtcaattttctttgttgtcatgagaggtaactttgatgctttacttcaatggccattc
tcataccgtgtgacattcatgctccttgatcagaacaataaagaacaccaggtggactca
tttcgccccgacccaaacagtagctctttcaaacgccccactacagagatgaacattgcg
agtgggtgcccactctttattccgcttgccaaacttgacgatccaagtcttgcgtatgtc
aaggaggacactatgtttatcaaactggtggtagatgtaccaaggggttga

DBGET integrated database retrieval system