KEGG   Crassostrea gigas (Pacific oyster): 105332907Help
Entry
105332907         CDS       T03920                                 

Definition
(RefSeq) glutathione S-transferase U19
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00480  Glutathione metabolism
crg00980  Metabolism of xenobiotics by cytochrome P450
crg00982  Drug metabolism - cytochrome P450
crg00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105332907
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    105332907
   00982 Drug metabolism - cytochrome P450
    105332907
   00983 Drug metabolism - other enzymes
    105332907
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:crg02000]
    105332907
Enzymes [BR:crg01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     105332907
Transporters [BR:crg02000]
 Other Transporters
  Pores ion channels [TC:1]
   105332907
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_N GST_C_5 GST_C_2 Glutaredoxin GST_C GST_N_4 GST_C_3 PilI
Motif
Other DBs
NCBI-GeneID: 105332907
NCBI-ProteinID: XP_011433950
LinkDB All DBs
Position
Unknown
AA seq 230 aa AA seqDB search
MTEMTAKLNFYCAWFCPFAQRAWIALLEKGVNFEYIEYNPYKEKTKEFLQLNPRGLVPVI
EVNGQSVYESDVCIEFIDEYGGPANRLLPAEPTARAKTRIVCGFISREIIPAFYGLLLKQ
DKNAQEKIKAALLHNLKTLLTYKPDSTPFFGGNKLGMADIMLVPFAMRFPVLSHYRGFVI
PETRDYESFHRWMKACKEQTSVIKTTCDIDKAIMVYQSYADGTANVRSKI
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaatgacagctaagctgaatttctactgtgcctggttttgtccctttgctcag
agagcatggattgctctcctggagaaaggtgtgaactttgagtacatcgaatataacccg
tacaaggaaaaaaccaaagagtttctccaactaaatccaagaggattggtcccagttata
gaggtgaatggccaatccgtctatgagtctgacgtttgtattgaatttattgacgaatat
ggcggtcctgcgaacaggctgcttccagctgaaccaacggcacgtgcaaagacgcggata
gtctgcggcttcatatcccgcgaaataatccctgctttttatggtttgctattaaaacaa
gacaaaaacgcccaggagaaaataaaagcagcactgttacataatttgaagactttgctt
acatacaaaccggattcgactccgtttttcggtggtaacaagttgggaatggcagacatt
atgttagtacctttcgccatgcggttccctgtgctaagtcattacaggggatttgtgata
ccagaaacgagggattacgagagttttcacaggtggatgaaagcttgcaaagaacaaacc
tcggtcatcaaaaccacctgcgatattgataaagcgattatggtttaccaatcctatgcc
gacggaactgcaaatgttagaagcaagatctaa

DBGET integrated database retrieval system