KEGG   Crassostrea gigas (Pacific oyster): 105333252Help
Entry
105333252         CDS       T03920                                 

Definition
(RefSeq) DNA ligase 3
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg03410  Base excision repair
Module
crg_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:crg00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    105333252
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:crg03400]
    105333252
Enzymes [BR:crg01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     105333252
DNA repair and recombination proteins [BR:crg03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     105333252
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP DNA_ligase_A_C LIG3_BRCT zf-CCHH BRCT_2 RNA_ligase mRNA_cap_enzyme
Motif
Other DBs
NCBI-GeneID: 105333252
NCBI-ProteinID: XP_011434445
LinkDB All DBs
Position
Unknown
AA seq 993 aa AA seqDB search
MPRIFQQACIIFFRCLQSNSKRTLSRSLQITKSEFVNAHTLKFFCVRSFHIPTERAMAEN
RYTTGYAKLGTSSCKKCKQKIDKGGLRIGKVVSNPFSDEGGDMKQWYHPQCMFETLKRAR
ATTKKIEEPDDLEGFTEIEQSDKDLINKLIKEFATHSSTKSPGSAKKKATSKVQATLPFS
PTKQKSDPGDEVYSAGPSTSALESDAPGHRDDSFREFRRLCAEIAEENSYLAKTKLVHDF
INKGSSGDGFKGDIYLWMKCLLPGVVKQVYNLNSKQLVKLFSQIFGASQDDMVADLDQGD
VAETVRLYFEESKRLPPQKKSLLSLQQVDNYLDELSKVTKEDDQQRILTKVAKRCTGNDL
KMFVRLIKHDLRINSGAKHILDALDDNAYAAFQASRNLRDVVDRVMENKAGGVPGMKKKL
SVKASLMTPVLPMLAEACRSVDQAMKKCPNGFYAEIKYDGERVQLHKKGHNFQYFSRSLK
PVLPHKVQHFKEFIPKAFPTGDDLILDAEVLLVDNKTSKPLPFGTLGVHKKAAFQDANVC
LFVFDCLHLNGENIMHKPIKERKKILETEMKEIPNRVMLSEAQLINDPDDLQTLMTKVFK
EGLEGLVLKDINSKYEPGKRHWLKIKKDYLEQGTMADSADLVVLGAYFGTGNKGGIMSIF
LLGVYDPSSSKWCTVTKCHSGLDDKTLEELQTSLDMVKISKNADKVPSWLNVKKQVVPDF
VTRDPKKSPVWEISGAEFSKADIHTADGISIRFPRITKFRDDKNWENATDLPRLRTLFKK
SKETTDLIPSSSEGTPKKKPLKDDDEDNDNNNEGDDSGTDINSDDDTGVSPMKTTPAKNS
ATPSKSTPLKATPTKNGVKRKHSDTGNGEITPSKKSKPMCKYGADCYQTNPTHLEQFDHP
PKTLPNVFRGCKIFLPTDTKLYRTLRRYIIGWDGELVPEYDKASATHVVLDKGHKGDIVK
CAGVCLTLDWIKMCIKKKMLVRTDPYLVGDDYE
NT seq 2982 nt NT seq  +upstreamnt  +downstreamnt
atgccaaggatattccagcaagcttgcatcatattcttcaggtgtcttcagtcgaattca
aagagaactttgtcaaggtctttacaaattacaaaatctgagtttgtaaatgcccataca
ctcaaattcttttgtgtcagaagttttcacattcccacagagagagccatggctgaaaac
agatataccacaggctatgctaaacttggaacttccagttgtaagaaatgtaaacaaaag
attgataaagggggactaagaattggaaaagtggtgtcaaacccattctctgatgaaggc
ggtgacatgaaacagtggtaccacccacagtgcatgtttgaaaccctaaagagagccaga
gccaccacaaagaaaattgaggagccagacgatcttgaaggattcacagagatcgagcag
tctgataaagatttgatcaataagttaatcaaagaatttgccactcactccagtacaaag
tctccaggctctgcgaagaaaaaggcaacatccaaagtacaggccactctgcccttttcc
cccacaaagcaaaagtctgatcctggtgatgaagtttattcagctggtccttcaacgagt
gccttggaaagtgatgctccgggccacagagatgactcattccgagagttccgacgcctt
tgtgcggaaatcgcagaggagaattcctacttggctaaaactaaacttgtccatgatttc
attaacaaaggctcctctggagatgggtttaaaggtgacatttacctgtggatgaagtgt
ctgttacctggagtagtgaagcaggtgtacaaccttaacagtaaacaactggttaaactg
ttcagccagatatttggtgcaagtcaggatgacatggttgcagatttggatcagggtgat
gtcgcagagaccgtcagattgtactttgaagagagcaagcgattacccccacaaaagaag
agtttactctctttgcagcaggttgataactaccttgatgaattatccaaagtaaccaag
gaagatgaccaacaaagaattctcactaaggttgctaagaggtgcacagggaatgatttg
aagatgtttgtgagattgataaagcatgaccttagaataaactctggagcaaagcatata
ttggatgccctggatgacaatgcgtacgctgccttccaagcgtccaggaatctgagggac
gtagtggaccgggtgatggagaacaaggcaggaggagtgccggggatgaagaagaagctc
agtgtcaaagcctccctcatgacccctgtccttcccatgctggcagaggcttgtaggtca
gttgaccaggcaatgaagaagtgtcctaatggtttctatgcagagataaagtatgatgga
gagagagtacaacttcataaaaagggacacaactttcagtatttcagcagaagtctaaag
ccagttttaccccacaaagtccagcattttaaggagtttatcccgaaggcctttcccact
ggtgatgatctcattctggatgcagaggttttattagtggacaataagaccagcaaacca
ctcccgtttggaacactaggagttcacaagaaagctgcatttcaagatgctaatgtctgc
ctgtttgtgtttgattgtcttcatttaaatggagaaaatattatgcacaaacctataaaa
gagagaaagaagattctggaaacagagatgaaagaaattcccaacagagtcatgctttct
gaggcccagctcattaatgatcctgatgatcttcaaacattgatgacaaaagtattcaag
gaaggcctcgaggggcttgtcttaaaggacattaatagtaagtatgagccaggaaaacgt
cactggctgaagatcaagaaggactacctggagcaggggacgatggccgactcagcagat
cttgtggtgctgggggcgtacttcggaacaggaaataaaggtggtatcatgtccatcttt
ctgttgggtgtctatgaccccagcagcagtaagtggtgtacagtgaccaagtgtcacagt
ggtctagatgacaagactttggaggagcttcagacatcgctggacatggtcaaaattagc
aagaatgccgacaaggtaccaagttggctgaatgtaaaaaagcaagttgtgccagacttt
gtgacgagagaccccaagaagtcaccagtctgggagatttctggcgcagagtttagcaag
gctgatatacacactgcagatggaatttccataaggtttccccgaatcacaaagtttagg
gatgacaagaattgggagaatgcaacggatttgcccagactcagaaccctcttcaagaaa
tcaaaggaaaccacagacctcatcccaagctccagtgaagggaccccaaaaaagaaaccc
ttgaaggatgatgatgaagacaatgataacaacaatgagggggatgacagtgggacggac
ataaacagtgatgatgacacaggggtatctcccatgaaaaccacccctgccaaaaacagt
gccacaccctcaaaatccacacccttgaaagctacaccaacaaaaaatggggtgaagagg
aaacatagtgacactggaaatggggagataactccatccaaaaagtcaaagccaatgtgc
aagtatggagctgattgctaccagaccaaccccacacatctggaacagtttgaccatcct
cctaagactcttccaaatgtattcagaggttgcaaaattttcctgccaacagacaccaaa
ttgtacaggacacttagaagatacatcattggttgggatggtgaattggttcccgagtat
gataaggcttcagcgacccatgtggtattggacaaaggccacaaaggtgacatagttaag
tgtgcaggggtgtgtttaaccttggactggattaagatgtgtataaagaagaaaatgttg
gtcaggactgacccctatctagtgggtgatgactacgagtga

DBGET integrated database retrieval system