KEGG   Crassostrea gigas (Pacific oyster): 105333497Help
Entry
105333497         CDS       T03920                                 

Definition
(RefSeq) sucrase-isomaltase, intestinal
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00052  Galactose metabolism
crg00500  Starch and sucrose metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105333497
   00500 Starch and sucrose metabolism
    105333497
Enzymes [BR:crg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     105333497
    3.2.1.20  alpha-glucosidase
     105333497
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil OppC_N
Motif
Other DBs
NCBI-GeneID: 105333497
NCBI-ProteinID: XP_019924964
LinkDB All DBs
Position
Unknown
AA seq 937 aa AA seqDB search
MANYNAVDEEAKVKNKRKMVIVFTFIAVILVCAIAAPIIISQSKPQYQYKHTGLPQQQLT
SQNDVMVDCSGRKGTESECKQNGCIWQRTKNPRAPRCIYPKTMGYQIEGQVRSTDQSLQF
SIRQKLNKTIFDTDIHQLVDVRVDMYSPKSLRIKFMPNGTSKPFEIPEEAIPVNDEHQAG
EKLYNVTIQRGPVFGIIVTRRSTGTVVFNSSVPGLMLSEQFLQITNRLPSGNLYGFGEHN
HQRFKHDLNWKTWPMFTRDTTPTDDWNLYGSHPVYMNVERDGNANMVFLRNSNGMDIQVQ
PEPFPAVTYRVIGGVLDFFVFLGPTPGEAVQQYVKTVGMPVMPPYWSLGFHLCRYGYKNL
AEMQSVRQRNINAGIPFDTQWADIDYMYKKFDFTYDKVKFSKFPDFTNELHNSGQKLVVI
VDPGVGANQNIYKEAQKNSPGYDMYNDGQRRDIFIKMNGSELQGQVWPGLTVFPDFTNLK
NTTEFWKYWIRYFMQNETIHADGLWIDMNEPSNFVAGSQRGCQRNRWNNPPYVMPILEGE
KDNGSLYYQTICMDAEQHWGKHYDVHNLYGHSESMVTNRALRELFPGKRPFILTRSTFSG
TSAYAAKWLGDNRSQWSDMHWSIVGLLEFSIFGFPMIGADICGFNGNATYEMCLRWHQLG
AFYPFSRNHNGIYQTSQDPGAWNQTFTSNVRRHLSLRYKLLPYTYTLFKEAHVQGTTVVR
PLMFEFPADSHTWDIDNQFLLGSSLLISPVLQENVRRIQAYFPKGRWFDYYKGVEIPGPE
SGRNVTLNAPLSNLNLHLRGGNIIPVQKPGNTTKTSRLNPMGLLVALNENLEAFGTLFLD
DGESDYSFQNGIYLELQFHFYGGERLDINVVHNKFTPAGNLTFNTIDIYGLHRHPSDVIV
DGSHIKSASQISNIIRLSGFQLDVTNNHTITLEMDKR
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atggcgaactataatgcagtggacgaagaggcaaaagtgaaaaataaaaggaaaatggtg
atcgtgttcactttcattgccgtgattttggtgtgtgccattgcggcacctataattatt
agccagtcgaaaccacagtaccagtacaagcataccgggttgccgcagcagcagctgacg
tcgcaaaatgacgtcatggtcgactgttccggaagaaaaggaaccgagagtgaatgtaaa
caaaacggatgtatttggcaaagaacaaaaaatccaagggccccacgttgcatatatccc
aaaactatgggatatcaaattgaaggacaagtgaggagtacggaccaatcgcttcagttc
tccatccgacagaaactcaataaaactatctttgacacagacatccatcaactggtggac
gtcagagtggatatgtacagtccgaaaagtctcagaattaagtttatgccaaatgggaca
tcaaaaccgtttgaaataccggaggaggccatacccgtgaacgacgaacaccaggcaggg
gagaaactgtacaacgtcaccattcaacgggggccagtgttcggcatcattgtcaccagg
cgatctacagggacggtggtattcaattcgtcagttcctggcctcatgctgtccgaacag
ttcctccaaatcaccaaccgccttccctcgggaaacctgtacggattcggagaacacaat
caccagcgattcaagcacgacttgaactggaaaacatggccgatgtttacacgtgacacc
actcccactgatgattggaacttgtatgggtcgcaccccgtgtacatgaatgtcgagagg
gacggcaatgctaacatggtgtttctcaggaacagcaacggaatggatatccaagttcag
cccgagcctttccccgcggtcacttaccgcgtcattggaggggtgctggatttctttgta
tttttgggcccaacacctggtgaagctgttcaacaatatgtaaagacagttggtatgccg
gttatgcccccatattggtcgctagggttccacttatgtcgctatggttacaaaaatcta
gcggaaatgcagagtgtacggcaaaggaatattaacgcagggattccgtttgacacccag
tgggccgatatagattacatgtacaagaagtttgatttcacctacgacaaggttaaattt
agtaaattcccagattttacgaacgagctgcacaacagtggacagaaattggtggtcatt
gtggatcctggcgtaggcgccaatcagaatatttacaaagaggctcagaagaacagtccc
ggctatgatatgtacaatgacggacaaaggagggacatcttcataaagatgaatggctca
gagctccagggacaggtttggcctggtcttacagttttcccagattttaccaacttgaag
aacactacggaattttggaagtactggattcggtactttatgcaaaacgaaacaatacac
gcagatggactatggattgacatgaatgaaccatcaaattttgttgctggatcccaacga
ggttgccaaagaaacaggtggaacaacccgccatatgtgatgcccattttggaaggagag
aaagataacggaagtctctattatcagacgatctgtatggacgccgagcagcactggggg
aagcactacgacgttcacaatctgtatgggcacagtgagagtatggtcaccaatagagct
ttacgggaattatttccgggaaagaggccgtttatcctgacccgatcaacgttttccgga
acctcggcgtacgctgccaagtggctgggggacaaccggagccagtggtccgatatgcac
tggtccatcgtcggtcttttggaattcagcatatttggatttccaatgattggagccgat
atttgcggctttaacggaaatgccacatacgagatgtgcttaagatggcatcagttaggt
gcattctacccattctccagaaaccacaatggaatttatcaaacgtcacaggatcctgga
gcttggaaccagacttttacttccaacgttcgacgtcacctaagcttgcgatacaagcta
ctgccatacacgtacaccttgttcaaagaggcccacgtccagggcaccactgttgtaagg
ccgcttatgtttgagttccctgcagacagccatacctgggatatagacaaccagtttcta
ctgggatcgtcattgctgatatctccggtgctgcaggagaacgtgagacggatccaagcg
tactttcccaagggaaggtggttcgactactacaagggggtcgaaatcccagggcctgaa
tcgggtaggaacgtaacactgaacgcccctctgtcgaacttaaacctccatctccgcggc
gggaacatcatcccggtccaaaagccaggcaacacgacaaaaacaagccgtttaaatccg
atgggacttttagttgcactgaatgaaaatttggaggcgttcggaaccctcttcctggat
gatggggaaagtgactattcctttcaaaatggaatttacttagaacttcagtttcatttt
tatgggggtgagaggctcgacattaacgttgtacacaacaagtttacccccgccgggaac
ttgacgttcaacaccatagatatttacggtttacacagacacccaagtgacgtcatagtt
gacggaagtcatataaagagcgcgtcccaaatatctaacattatccgcctttctggtttt
caacttgacgtaactaataaccatacgattacgctagaaatggataaaagatga

DBGET integrated database retrieval system