KEGG   Crassostrea gigas (Pacific oyster): 105337089Help
Entry
105337089         CDS       T03920                                 

Definition
(RefSeq) succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00020  Citrate cycle (TCA cycle)
crg00190  Oxidative phosphorylation
crg01100  Metabolic pathways
crg01200  Carbon metabolism
Module
crg_M00009  Citrate cycle (TCA cycle, Krebs cycle)
crg_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
crg_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    105337089
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105337089
Enzymes [BR:crg01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     105337089
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 105337089
NCBI-ProteinID: XP_011439961
LinkDB All DBs
Position
Unknown
AA seq 664 aa AA seqDB search
MASVFKLPGNILQKSSLTNFLTKAVKPVSASGSRDFHFKFQRTNQASSAGDKISKQYPVI
DHTFDAVVVGAGGAGLRAAFGLANEGFKTACITKLFPTRSHTVAAQGGINAALGHMEEDH
WHYHFYDTVKGSDWLGDQDAIHYMCEEAPKAVIELENYGMPFSRLENGKIYQRAFGGQSI
NYGKGGQAHRCCCVADRTGHSLLHTLYGRSLKYDTSYFIEYFALDLIMEDGECRGVTALC
LEDGTIHRFKSKNTVLATGGYGRAYFSCTSAHTCTGDGTAMVARAGLPNEDMEFVQFHPT
GIYGAGCLITEGSRGEGGYLVNSKGERYMERYAPSAKDLASRDVVSRASTIEIREGRGVG
PEKDHVFLQLSHLPPEVLKTRLPGISETAMIFAGVDVTRDPIPVLPTVHYNMGGTPTNYK
GQVIEYVNGQDRVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACANTITAECKPG
DTIGKISPNAGEESVANIDKLRHANGSQTTADIRHKMQKAMQNHAAVFRDGPALKEGVDK
MYAINKEMDDVKLSDRGMIWNTDLVETLELQNLMVNALQTIVAAEARKESRGAHSREDFK
ERLDEYDYSKPLEGQKKKPVEQHWRKHTLSYTDNKGQTTLEYRPVIDTTLNKECEAVPPA
VRSY
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggtcttcaagctaccgggaaatattttgcaaaagtcatcattgacaaacttt
ctaacaaaagcagtcaagcctgtatctgcctctggctctagggattttcatttcaagttt
caaagaacaaatcaagcgtccagcgcaggagacaagatctccaagcagtaccctgtaatt
gaccacacatttgatgctgtagtggttggtgcaggaggggctggacttagagcagccttt
ggattggctaatgaaggatttaaaacagcatgcataacaaaactgtttccaactcgttcc
cacacagtggcagctcagggaggtatcaatgcagcccttggacacatggaggaggatcat
tggcattatcacttttacgacacagtgaagggatctgattggctgggagatcaggatgca
atccattacatgtgtgaggaagcccccaaggctgttattgagctcgaaaactatggcatg
ccgttcagcagacttgagaacggtaaaatttaccagagagctttcggaggtcagagtatt
aactatggtaaaggaggacaagcccatcgctgttgctgtgtagctgaccgaactggacac
tccctccttcacaccctttatggcagatctcttaaatacgacacctcttacttcattgaa
tattttgcccttgatttaatcatggaagatggagagtgtaggggagtcactgccttatgc
ttagaggatggcacaattcacagatttaaatccaagaacacagtccttgccactggtgga
tatggacgagcctatttctcatgcacctcagcccacacctgtacaggagacggcactgcc
atggtagccagagctggactccctaacgaagacatggagtttgttcaattccaccctaca
ggtatttatggagctggctgtctaatcactgagggctctcgtggagaaggtggctacctc
gttaactccaagggtgagcgatacatggagagatatgccccgtctgccaaagatctcgct
tctagagacgttgtctccagagctagcaccattgaaatccgagagggaagaggagtggga
ccagagaaggaccacgtcttccttcagctctcccaccttccacccgaggtgttgaagacc
cgcctgccaggaatctccgagactgccatgatcttcgcaggggtggatgtgacccgtgat
cccatcccagtcctccccacagtacactacaacatgggaggaacacccaccaactacaaa
ggacaggtgatagagtacgtgaacggccaggatcgagtggtcccaggcctgtatgcctgt
ggggaggccgcctgtgcctctgtacacggtgccaacagactgggagccaattccctgctt
gatctcgtggtctttggcagagcctgtgctaacaccatcactgcagaatgcaagccagga
gacaccatcggcaagatcagtccgaatgctggagaagaatctgtagccaacattgacaag
ctgcgccatgctaacggcagccagacaacagctgatatcagacacaagatgcaaaaggca
atgcagaaccacgcggctgttttcagagacggaccagcactgaaggaaggagtagacaag
atgtatgctattaacaaagaaatggatgatgttaagttgtccgacagaggaatgatctgg
aacacagatctagtggagaccctggaattacagaacctgatggtcaacgccctccagacc
attgtcgcagccgaggcaaggaaggagagcaggggagctcactcacgagaggacttcaag
gaaaggttagatgagtatgactacagtaagcctctagagggacagaagaagaagcccgtg
gagcagcactggaggaagcacaccctctcctacacagataacaaaggacagacgacctta
gaatacagacctgtaattgacacaacactaaataaggagtgtgaagccgtgcccccagct
gtcaggtcttattaa

DBGET integrated database retrieval system