KEGG   Crassostrea gigas (Pacific oyster): 105339311Help
Entry
105339311         CDS       T03920                                 

Definition
(RefSeq) translocation protein SEC63 homolog
  KO
K09540  translocation protein SEC63
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg03060  Protein export
crg04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:crg00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    105339311
   04141 Protein processing in endoplasmic reticulum
    105339311
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:crg03110]
    105339311
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:crg02044]
    105339311
Chaperones and folding catalysts [BR:crg03110]
 Heat shock proteins
  HSP40 / DNAJ
   105339311
Secretion system [BR:crg02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   105339311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sec63 Ski_Sno
Motif
Other DBs
NCBI-GeneID: 105339311
NCBI-ProteinID: XP_011443129
LinkDB All DBs
Position
Unknown
AA seq 280 aa AA seqDB search
LMNYLSNLDENYREKLLCYPYSDKARALLLAHFLRLELSPATLAIVSKLLCYPYSNKARA
LLLAHFQRLELPPATVAIDQAYIVRKCPYLINEMINVIAQLVAGAYRNEMDLEYMPRLET
IENCMKLSQMLIQAVDVQTSPLLQLPHITQDMLKHFTTKEIDIKNIRDLIGMKEEDRCPL
LSFLTANQYHDIMSVCASLPFVKMKVYCLVLDDEDTSITAGSIVTVYVKLKRQMMEVMFD
KKMLSQEDEDQDNMIIANQDNDFNKYQFILQEEAKKERER
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
ttgatgaattacctttctaacctggatgagaattacagagaaaagcttctgtgttacccg
tacagtgacaaagccagggccttgctcctcgcccattttctgagacttgaactatcccca
gccacactggctattgtctctaagcttctgtgttacccgtacagtaacaaagccagggcc
ttgctcctcgcccattttcagagacttgaactacccccagccacagtggctattgaccag
gcgtacattgtaagaaagtgtccctatttgattaatgagatgattaacgtcatcgcacag
ctggtagctggagcttacagaaacgaaatggatcttgaatacatgccgcgactggagaca
atagagaactgtatgaagctgtctcagatgttgattcaggctgtggacgtccagactagt
ccactgttacagctcccccacatcacccaggacatgcttaaacactttacaactaaggag
atagatattaagaatattcgtgatttaatcggcatgaaggaagaggataggtgcccactg
ctcagtttcttgacggcaaatcaatatcatgatatcatgagtgtgtgcgcatcactaccg
tttgtcaaaatgaaggtctattgcctagttttggatgacgaggatacgagtataacagca
ggctctattgtaactgtgtatgtaaaattgaagcgacagatgatggaggtaatgtttgat
aagaaaatgctgtctcaagaggatgaagatcaggataacatgatcattgcaaatcaggat
aatgatttcaacaaataccagttcatacttcaggaggaggccaagaaagaaagagaaaga

DBGET integrated database retrieval system