KEGG   Crassostrea gigas (Pacific oyster): 105340311Help
Entry
105340311         CDS       T03920                                 

Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific-like isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:crg00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    105340311
Enzymes [BR:crg01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     105340311
Chromosome and associated proteins [BR:crg03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     105340311
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1 Methyltransf_4
Motif
Other DBs
NCBI-GeneID: 105340311
NCBI-ProteinID: XP_011444575
LinkDB All DBs
Position
Unknown
AA seq 1755 aa AA seqDB search
MENELRLHSPVGAEPVVYTWPLSSSDGKDGATEVIETIRFVAKDVPELDSALKSHILQDY
EVDSFESMKNVCDKYNRTIDSIRQLWKGTSRQSELMGRPSTGLLKHILQQCYNLAVSDPE
KLNQYEPFSPEVYGETSFDLVDQMIKSINFSEDDYFIDLGSGVGQVVLQVAAATPCKMCY
GIEKAEFPAKYAETMAKEYERWMSWFGKKHGQYKIEKGDFLCEEVKEKINNATVIFVNNF
AFGPQVDHQLKLRFANMKEGAKIVSSKAFCPMNFRITDRNLSDIGTIMHVAELSPLSGAV
SWTGKPFGYFIHTIDRTLLEKYFLRMKNPKMKDEEDVRKDRKGRPLTLRDKNNINNKEKE
EVKNGVLRRRSRMCVSNVDSSSNSSFPASRNLDFDSASNTSTATSCTTMDENTQVPGTTT
RRQWSEWVTSRPLSHSAVLSDRDGEESESSHVDVEEEDPKVTKQIEKPMKIKRNLKKDKP
VGGRKKTNFSRQSRAKKNKEKAKTKVLGLDSLNLLHTHTLMSTAKSDSPPENTMKWNDIS
MTSVSSSYFKPTTQSRSISSLESEPPALQHLLDLFKQQYMQFISYMKSPQYKIAIQQEIE
REKQKQLQLRAKAMHLEVQISGLQKEGVSRLKQRMKELGISAENPSEFLTQAKKIVTGHK
ELQGHLNNIQGQVSSLEMERNKLVGETNQRILGQKNGHKNGFIKPELTNDLIKHVSTTYS
QKKKLLNKVKELEAEVQALESENQHLTEVEKENFIRLAQGQKLVPNLYQRLGDLSKAAIP
SPIVIPLTTTAIPSCTAVSSSSVTPSTSALSSATPSVKTVKSVYVAQPSGKCSQVVEAVP
ISGMRSILSPTSQSSGIIPSSSTVQTTPASAATVQVSNSSSKPEVKVKNNLSLQSLLEAS
AMQREKRQDMKSIVNMVEKVKNQPIKEIKVLPKNGVKPTIIALHGMPKPSLPVKIPLGKV
KTEEVQSKPSLPVSIPLDKAKLEDINKNKTFPSTKEEAIKTERLMSMYSPISRSSSVDST
DTAEDSPQSSGSLLKGSSSSNSLIRNVLDGKASLHSGGRTINNYIKDVVRDQITGASAKQ
VSSVLTNHSRSEDRTMSQKLNLAEALIQMSETHNHIKSKSVPTLNNKTQVHVKQPTIVKR
KHKDQISSSVPKKPRTESSWTSPASSCSETLTASSIRTPGSEFSTRTNSPLFTKAAVKEH
RTDKLSYRDSPSKPKGRDITSEFDALLALASSELTKNKQTEKQNKSSYHRHNNVHRKSST
RSHHDHSRSAPYTKIKLSGPRTPPGSPPNHRQGPRTPPGSPTQGLKNHRIDSRSSHVNSR
QRNLSNRGRAHYRRSDTHGSYSSKSRSPSYDSSRSSQSRSSSSSSCSSGCSYSSRSRSRS
SSCSSSCSRGAPAKRAPIKQQPSTPKPGVSPGKASISTQPIALKTSIPSATLNGSYRIVH
STATLNNPTMMIMANNPVNSGNNLIQSASLGNQAIPASSLPNNVVVLQLMPQNSGASGQI
IRTSIPGTLVTSQPPPAQGKTVNNFTQPLQQTPQVPPPPLPPGSNVVPLNNGLVPPTNAV
QPNGFQFTLDNRGGTFSFPDLTRPPPNIAVNPSNVSLPMPVGNTNRPLLPLPKGQQKRLP
SPRGQASILTINHRQQGSPSNVSIQPRPNHNTVQNGFQPNMNNNFSPPQKFGETQRGQTL
KPRIPQQMNFRGSQVTIQPAPSGVMQGNNSNARPRYTTFTVPFQVFNKDQGNVQQQFGTQ
MQTVIVEEKISSPSK
NT seq 5268 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgaacttagacttcacagtccagtgggagcggagccagtggtatatacgtgg
cctttatcatcttcggatggtaaagatggagccacggaggtcatagaaacgataagattt
gtagctaaggatgttccggagctggactctgccctcaagagccatatcctccaggattat
gaagtagacagttttgagagcatgaagaatgtctgtgacaagtacaacagaaccatagac
agcatccgacagctatggaaaggcacgagcagacagagcgagctgatgggtcgtccctcc
acggggctactgaagcacatactacagcagtgttacaacctggcagtgagtgatccagag
aaactgaaccagtatgaaccgttctcaccagaggtgtacggggagacttcctttgaccta
gtagatcagatgatcaagtccatcaacttcagcgaggacgactacttcattgatctagga
agtggtgtcggacaggtggttctccaagtggcagccgctacgccctgtaagatgtgttat
ggaatagagaaagcagagtttccagctaagtatgcagagacaatggcgaaggaatatgag
agatggatgagttggtttgggaagaaacacgggcagtacaaaatcgagaagggcgacttc
ctgtgcgaggaagtgaaggagaaaatcaataacgccacggtgatatttgtgaacaacttt
gcctttggcccacaagtagatcatcagttgaagttgaggtttgccaacatgaaagagggt
gccaaaatcgtctcctccaaagccttttgtccaatgaacttcagaattacagacagaaat
ctgagtgatattgggacgatcatgcatgtagccgagctgtccccactaagtggtgctgtt
tcttggacagggaaaccatttggctactttatacacaccattgatagaactctgcttgaa
aaatatttcttgagaatgaaaaaccccaaaatgaaggatgaagaggatgtgaggaaggac
cgtaaaggtcgtcccctgaccctgagagacaaaaataacatcaacaacaaagaaaaggag
gaagtcaagaatggcgtcttgaggcgcagaagccggatgtgtgttagcaatgtagacagc
agttccaacagctcattccccgcctcccgcaacctggactttgacagtgccagcaacacc
agcaccgcgaccagttgcaccaccatggatgagaacacccaggtacctggcaccaccaca
cggcgacagtggtcagagtgggtcaccagcaggccattgagccactcagcggttttgtcg
gacagggacggggaagaaagtgaaagttctcatgtggatgttgaggaagaagatccaaaa
gtcaccaagcagatagaaaagccaatgaaaataaagagaaacttgaaaaaagacaaacca
gtgggcgggagaaagaaaaccaattttagtcgacagtctcgtgcaaagaaaaacaaggaa
aaggcaaagacaaaagttttgggattggatagtctgaatttgctgcatacccacacattg
atgtctacagcaaaatcagactcgcccccagagaacacgatgaagtggaatgacatcagt
atgacctcagtgtcctcgtcttacttcaaacctaccacccagagtcggtccatctcgtcc
cttgaatcagagcccccagccctgcagcatcttctagatttgtttaaacagcagtacatg
cagtttatatcttacatgaaaagcccccagtataaaattgccattcaacaagaaattgaa
agagaaaagcaaaaacagctacaactaagagccaaagccatgcaccttgaggtgcagata
tcagggctacagaaggagggagtgtcacggctgaagcagagaatgaaagagcttggtatc
agtgctgagaatccgtcagagtttctgacacaggccaagaagattgttacagggcacaaa
gagctccaaggtcatctcaacaacatccaaggtcaagtgtccagtctggagatggagaga
aacaaactagtgggtgaaacaaatcagcgtatcttaggccaaaagaatggacacaagaat
ggtttcatcaaaccggaactaaccaatgatttgatcaaacatgtcagcaccacttattcc
cagaaaaagaagctacttaacaaagtgaaagagctagaggcagaagttcaggctttggag
agcgagaaccaacatcttactgaagtagagaaggaaaattttatccgactagctcagggc
cagaaacttgtgccaaatctttatcaacgacttggggatttatcaaaggcagctataccg
tcacccatagtgatcccattaaccaccacagctatcccatcttgcacggctgtctcctca
tcttcagttacaccatcaacttcagctctctcatcagctacgccatccgttaaaactgtc
aagagtgtctatgtggcacaaccatcaggcaagtgtagtcaggtggtagaagctgtaccc
ataagtggaatgagaagtatcctgtctccaacttctcaaagctcagggatcataccatct
tcttcaactgtacaaaccacaccagcttctgctgctactgtgcaggtttcaaattcctcg
tcaaagccagaggtgaaagtgaagaataatttgtctttacaatcattgttagaagccagt
gctatgcagagggagaaaagacaagacatgaagtctatagtaaacatggtggagaaagtg
aaaaaccaacccattaaagaaattaaagtcctacccaagaatggagtcaaaccaacgatc
atagcactccatggcatgcccaaaccctcactccctgtcaagataccgctcggaaaggtg
aagaccgaggaggttcagtccaagccgtcgctaccggttagtattccactggataaggcc
aaactagaggacatcaacaagaacaaaacctttccctccacaaaggaagaagcgataaaa
acggagagacttatgagtatgtattctcccatcagcaggtcaagtagtgtggacagcaca
gatactgctgaagattcgcctcagagttcaggaagtttgcttaaaggtagttcatcatca
aactctttgattcgcaatgtgctggatggcaaggcaagtcttcattccggtggacgaaca
ataaacaattacattaaagatgtggtgagagaccagattacgggtgcctccgctaagcaa
gtgtcttcagtgctgacaaaccactccagatctgaagacagaaccatgtctcaaaaactc
aacctggcagaggccttgattcagatgtcggagactcataatcacatcaaatcaaaaagc
gtgccaacattgaacaacaaaacccaggtgcatgtaaagcagccgactatcgttaagcgt
aaacacaaagaccagatctcatccagtgtgccaaaaaaaccacgcacagaatcgtcctgg
acctctccggcttccagctgttcagaaactctcaccgctagttccatccggacccccggc
tcagagttttccaccagaacaaacagtcccctcttcactaaagcagctgttaaagaacac
agaacagataagttgtcatacagagattcccctagtaagccaaaaggaagggacatcact
agtgagtttgatgctttactggcactagcatcatcagagctaacgaagaataaacagact
gaaaaacagaacaagtccagctatcaccgtcataataatgtacacaggaaatcgtcaact
agatctcatcatgatcattccagaagtgccccttacacaaagatcaaactttcagggcca
agaacaccccctgggagccccccaaatcacaggcagggtccacgcacaccccctgggtcc
ccaacccagggcctaaagaaccataggatagattcaagaagttcacatgtcaacagtaga
cagaggaatttgtccaatcgcggtcgagcacattacaggaggagtgatacccacgggtcg
tacagtagtaaaagccgcagtcctagttacgactcaagtcgaagcagtcaatctaggtca
tctagcagctcttcttgtagttcagggtgttcctattctagcagaagtaggtcacgaagt
tccagctgcagtagcagctgtagccggggtgcaccagctaaaagggcaccaataaaacaa
caaccaagtactcctaaacctggcgtatccccgggaaaagctagcatcagtacgcaacct
atagcattaaaaaccagtatacctagtgctaccttaaatggcagctatcgtattgtgcat
agcactgcaactttgaataatccaacaatgatgattatggccaataatccagttaattca
gggaataatttaatacagtctgcttctttggggaaccaggctatcccagcttcatcgctg
cccaacaatgttgtagttctgcaattaatgccacagaactcgggagccagtggacagatt
ataagaacttcaatcccaggcactctagtgacgtcccagccaccaccagctcagggtaaa
actgtcaacaacttcacccagccactacaacagaccccgcaggtgccccctccccctctt
cctccaggtagcaatgtagtcccactcaacaatggactagtgcccccaaccaatgctgtc
cagcctaacggatttcagtttaccttggataacagaggaggcacttttagttttccggat
ttaacacgtccacccccgaacatagcagtgaatccatctaatgttagtcttcctatgcct
gtgggtaacaccaacagaccactgctgcctttgcccaaagggcagcaaaaaaggctgccc
tcaccccgtgggcaagcatccattctgactataaaccatagacaacaaggcagtcccagt
aatgtgtccatacaacccagacccaaccataacactgtccaaaatggattccaacccaac
atgaacaacaatttctcgccccctcagaagtttggcgaaactcaacgaggccagactctg
aagccccgcattccacagcagatgaatttccgcggatctcaagtcacgatacaaccggca
ccatcgggtgtcatgcagggaaacaactctaatgctagacctcggtacaccacttttaca
gtgccattccaagtgtttaacaaggatcaaggaaatgttcagcaacagttcggaacccaa
atgcaaactgttatagttgaagaaaaaatatcatccccttcaaaataa

DBGET integrated database retrieval system