KEGG   Crassostrea gigas (Pacific oyster): 105340925Help
Entry
105340925         CDS       T03920                                 

Definition
(RefSeq) maltase A3
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00052  Galactose metabolism
crg00500  Starch and sucrose metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    105340925
   00500 Starch and sucrose metabolism
    105340925
Enzymes [BR:crg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     105340925
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase SpuA_C hDGE_amylase
Motif
Other DBs
NCBI-GeneID: 105340925
NCBI-ProteinID: XP_011445493
UniProt: K1Q3M4
LinkDB All DBs
Position
Unknown
AA seq 592 aa AA seqDB search
MSSKKKFCETQKCLFVILVAVAAAIAAICVVTLTDENLREKRSLEPLPWWKTSIVYQIYP
RSFQDSDNDGTGDLRGIKERLGYLSDLGVGAVWLSPIFLSPMRDFGYDVRNYTDVDPLFG
NMADFENLISEAKDKNLRVILDFVPNHTSNESEWFYWSERGHKKYKDYYVWNSGIECAAG
CDDTGGRRPPNNWLSVFGGSAWKWSGIRQKFYYHAFLDSQPDLNLRNKNVQTELQDVLEF
WLQKGVDGFRADALKFMFESPNVTDDETGLTDTFTWIEADNHNLTTNLPEVYDILKGWRA
VLNKYGKDKFLIAESYGISHEIRDKYYESGSIPFNFALIQYLNKSCNALCMRDVIQDSLG
GLNSNWPNFVLGNHDNSRVANRFGPETIDAFNMLLLTLPGTPTSYYGEEIGMRDTFYTYR
ETKDTAGLNYNETQYMEHSRDPERSPMQWDDGLNAGFSNGTPWLHVNHNYQLINVKAQKL
ADRSHLKVYQQLAKLRQDPAFTHNSVQFVNISDVGGNDKTILAYIRAQINSDKYLVVMNF
GHQYANNVDLSKGAGSENGMVVVNAMSAYQKEMIDLKSVTLSRGQGLVIKVM
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtccaagaaaaaattctgcgagacacagaagtgtctgtttgtgattttggtggcg
gttgcggcggcgattgcggcaatttgtgtggtgactttgacggacgagaacttacgtgag
aagaggtcacttgaaccgctgccctggtggaagacgagtatagtgtaccagatttaccct
cgctccttccaggactcggacaacgatgggaccggtgacctcagaggaatcaaggagcgt
ctgggatacctgtcagatcttggggtgggtgcagtgtggctcagtccaatctttctgtcc
cccatgcgagactttggatacgatgtccggaactacacagatgtggacccacttttcgga
aacatggctgactttgaaaatctgatatcggaagcaaaggataaaaatttgcgagtgatt
ttggattttgttcccaaccacacgagtaatgagagtgaatggttctattggagtgagcga
gggcacaagaagtacaaagattactacgtctggaacagtgggatagagtgtgcagccggg
tgtgacgacacgggcgggagacggcccccaaacaactggctgagtgtattcgggggctct
gcttggaaatggagcggcatccgtcagaagttttattaccacgccttcttggactcccag
cccgatcttaatctacgtaataaaaatgtacagacggaactgcaggacgttctggagttc
tggttacaaaaaggggtggacggattccgcgcagacgcactcaagtttatgtttgaatca
ccaaacgtcaccgacgacgagactggcctaacggacacctttacatggattgaggcggat
aaccacaatttgaccacaaacttgccagaggtctatgatattctcaaaggatggcgcgct
gtcctgaacaaatacggcaaagacaagtttctgatagcggagtcctacggcatcagtcat
gaaatccgtgacaagtattacgagtccggttccatcccatttaactttgccctgattcag
tacctcaacaaaagttgtaacgcgctgtgtatgagagacgtgatacaggactctctgggg
ggactcaattctaactggcctaactttgtgcttggaaaccatgacaacagccgggtggcc
aaccgatttgggccggagacaattgacgccttcaacatgctgctgttgaccctccccggg
acccccacgtcttactacggggaggagatcgggatgagagacacgttctatacgtacagg
gagaccaaggacacagcgggcctcaattataacgagacccagtacatggagcattcccgt
gacccagagcgctcccccatgcagtgggatgacggccttaatgcggggttctccaacggc
acgccatggctgcacgtcaatcacaactaccaactcatcaacgtcaaggcacaaaagttg
gcggacagatcgcatctaaaggtataccaacaactggccaagctgcgtcaggatcctgct
tttacccataattctgtgcagtttgtaaatatcagtgacgttggcggaaacgacaagaca
atcctagcctacatccgggcccaaataaattcagacaagtacctggtggtcatgaacttc
ggccatcagtacgctaataacgtggacttgagtaaaggggccggaagtgaaaacggcatg
gtggtcgtcaatgccatgtctgcttatcagaaagaaatgatagacttaaaaagtgtcacg
ttatctcggggtcaaggactagtcataaaggtcatgtga

DBGET integrated database retrieval system