KEGG   Crassostrea gigas (Pacific oyster): 105341160Help
Entry
105341160         CDS       T03920                                 

Definition
(RefSeq) glycogen [starch] synthase-like
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00500  Starch and sucrose metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    105341160
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:crg01003]
    105341160
Enzymes [BR:crg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     105341160
Glycosyltransferases [BR:crg01003]
 Polysaccharide
  Storage polysaccharide
   105341160
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 105341160
NCBI-ProteinID: NP_001295851
UniProt: Q596I1
LinkDB All DBs
AA seq 695 aa AA seqDB search
MRRRNSFYRSFKDACPEFEEMLMDRGATAAAQNKWVFEIAWEVANKVGGIYTVIKSKAPV
SVAELGEQYCLLGPYNEACVRTEVEILEPSHYVYRQTLQTMRDAGIKVHFGRWLIDGYPK
VILFDIGSAAWKLDEFKHELWEKASIGIPWHDRESNDAVIFGALVAWFIGEFRKNLTDQP
IVVTHFHEWLAGAGLMDLRTRKVDCITIFTTHATLLGRYLCAGSSDFYNNIDKYNLVKEA
GDRQIYHCYCMERTAVHSSQVFISVSEITEVEAEHLLKRKPNMIVPPNGLNVVKFSTIHE
FQNMHAICKEKIHDIVRGHFYGHYDFDLDKTLYFFTAGRYEFSNKGADMFIESLARLNFY
LKQANSEATVVAFLIFPTKTNNFNVESLRGQAISKQLKETVHHVQTQIGKRIFEQSLKGK
ILTGDEILEQEDIVKLKRCIYSAQRNSLPPICTHNVNEDANDQILNALRRCQLFNRKEDR
VKVVFHPEFLNSTNPLFGLDYEDFVRGCHLGVFASYYEPWGYSPAECTVYGIPSISTNLS
GFGCFMQEHINDPKSYGLYIVDRRYKSPDESIHQLTQYMYDFTCLSRRQRIIQRNRTERL
SDLLDWRNLGVYYRKARQIAVARGYPDLAAKEEEILQEKRFMYPRPASEPSSPSASRSST
PAPSEHGDDEDDDIDEDEENAEMSSNPESDMPMFK
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atgagaagacgaaacagtttttacagaagttttaaagatgcatgtccggaatttgaagag
atgcttatggacagaggggccactgcagctgcacaaaacaaatgggtgtttgaaatcgcc
tgggaagtagcaaataaagttggtggtatctacactgtcatcaagtccaaggccccggtc
agtgtagctgagttaggagaacagtactgtctgctgggtccctataacgaggcatgtgtc
agaacggaggtggagatcctggagccctcccactatgtctacagacagacgctacagacc
atgagggacgcaggtatcaaggttcattttggtcgctggctgatagacggatatcctaaa
gtcattttgtttgacatcggatctgctgcttggaagctggatgaattcaaacatgagctg
tgggagaaagccagcataggaatcccctggcacgaccgcgagtcgaacgacgccgtcata
ttcggggctctagtagcctggtttattggtgagtttcggaagaatctgactgatcagccg
attgtagtgacccactttcacgagtggttggctggggcggggctgatggacctgcggacc
aggaaggtcgactgcatcaccatcttcacgactcacgccacactgctggggagatacctg
tgtgctggcagctcagacttctacaacaatatagacaagtataacttagtcaaggaggcc
ggtgaccgtcagatataccactgttactgcatggagaggaccgctgtccactcttctcag
gtgtttatcagtgtgtccgagatcactgaggtggaggcagagcacctgctcaaacggaag
cccaacatgatcgtcccacctaacggattaaatgtggtcaaatttagtaccatccatgag
ttccagaatatgcatgccatctgcaaggagaagatccacgacatcgtcaggggacatttt
tatgggcactatgactttgatctggataagacactatactttttcacggctgggagatat
gagttttccaacaaaggagcggacatgttcatagaatcactggcaagactaaacttttat
ctcaagcaagctaacagtgaggcgacagtggtggctttcctgatcttccccaccaagacc
aacaacttcaacgtggagtccctgcggggccaggccatctccaaacagctgaaggagacc
gtgcaccacgtacagacacagatcggcaagaggatctttgaacagagcctgaagggcaaa
attctaactggagatgaaattctggaacaagaagatatagtgaaacttaagaggtgtatc
tactctgctcagagaaacagcttacctcctatatgtacgcacaatgttaatgaagacgcg
aacgaccaaatccttaatgcccttcgacgatgtcaacttttcaacagaaaagaggacaga
gtgaaggttgtatttcaccccgagttcctgaactccaccaaccctttgtttggccttgac
tacgaggactttgtccggggctgtcaccttggggtgttcgcttcgtactacgagccctgg
ggctattcaccagctgagtgcaccgtgtacgggatcccaagtatttccacgaacctctca
ggcttcggctgtttcatgcaggaacacatcaatgatcccaagtcctatggactctatatt
gtagaccgccgatataagagtccagacgaatcaatccatcagctgactcagtatatgtat
gatttcacctgtttatcccggcgacagcgtatcattcagagaaatcgtacggagcgcctc
agtgacctcctagactggaggaacctgggagtgtactacagaaaagcccgccagattgct
gtagcccggggataccctgaccttgctgccaaggaggaggagatcctacaggaaaagagg
ttcatgtaccctcggccggcctccgaaccttcctcaccctcggcctcgcgcagctccacc
ccagccccctcggaacatggggacgatgaagatgacgatatcgacgaggatgaagagaat
gcggaaatgagttctaacccagagtccgacatgccgatgtttaagtga

DBGET integrated database retrieval system