KEGG   Crassostrea gigas (Pacific oyster): 105344352Help
Entry
105344352         CDS       T03920                                 

Definition
(RefSeq) uncharacterized protein LOC105344352
Organism
crg  Crassostrea gigas (Pacific oyster)
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_2 Ank_4 Ank_5 Ank_3 Ank
Motif
Other DBs
NCBI-GeneID: 105344352
NCBI-ProteinID: XP_011450415
UniProt: K1R827
LinkDB All DBs
Position
Unknown
AA seq 808 aa AA seqDB search
MKIINAHNCNNHVINMSKRVKTKPKVRANVGTGMTRKNVDDKESADRIAAAEAMSCLSST
PFILPSSSDAIVKAVTDQRLETMGDTASNQDMIMTVSKRGKSKQRRGGKRSPVKTQQTNS
DITENNVTVSQNSNPSGTISNDSCKPSTSHQNVINFESVNTASISQASLIAQQLSNLVKI
QKEKQEKADAMPSHSNIKFSLQQMLELKRTQSQDHSQSSTNSVLKLPLTVSTTESNIARD
MASPSSVTSSESIELPQTTVDHILNSNKYDTPEASLPLKKRRLQTYKDGEVPATESGLPS
QKMVDLTTDKQDQNKDHNRKQQVDISKTGSSGMFVNPQMSLMLLNEIQMALHQDEDGDLP
LHIAVAQENIVMVQKFVHLMTISGKNVDKYNKSLQTPLHLAVELQFDQAVSVLLMAGANP
SLVNNEGDSAVHLAVKHNTINNLALMLIKSQHKADINARNFEGLAPLHLAVIKNQIEMVK
VLIRCGADINIQDGKSGRTPLFHAVEGNQLALVMLFRQCNANLELTNYAGITALMAAQAK
GFSEASSVLMVGLDPKAIIEHKEKEKMMMPNKKMPIPRIPSKAHLIVPVNQRGIKKESNS
ENETSSQGNSQESEDVKQRMEEKTDTQQLYERAVMEFKMKREIQDSEVGALEIDRKEIVE
QKPLQLTVNLPVKKEKQKRNKQKKLKKEIKQDSDIEISSEVVVQTVPHKGPVNSVVENSE
CKTTLESMNNTSKTVPVSGTNAAKPVSTAENVTSINARTASLLAAHLKSMKNALTSSKHG
SSFPLNLSCDGKETVNFETTSTTLSNGS
NT seq 2427 nt NT seq  +upstreamnt  +downstreamnt
atgaagattattaacgcccataattgtaataaccacgtcataaacatgagcaagagagtg
aaaacaaaaccaaaagtaagagccaatgtaggaactgggatgacgcggaaaaatgtcgac
gataaggagagtgcggaccgtattgctgcagcggaggctatgtcgtgtctttcctctaca
cccttcattctgccgtcctcttcggacgccattgtcaaagctgtgacggaccagagacta
gagaccatgggtgacactgcctcaaatcaagacatgatcatgactgtctcaaaaagggga
aaatctaaacagcgccgagggggtaagcgatctccagtaaaaacacagcagacgaactct
gatataacggagaataatgttactgtaagtcagaactctaacccatccggtacaatttcc
aatgactcatgtaaacctagtacatcccatcagaatgttattaattttgaaagtgtcaat
acagcatcaatatcacaagcatcattgattgcacagcagttaagtaatcttgtaaagata
cagaaagaaaaacaagagaaagctgatgcaatgccatcacattccaacatcaagttttcc
cttcaacaaatgttagagttgaaaaggacccaaagtcaggaccattcacaaagttcaaca
aactctgtgctaaaacttcccctaacagtgtccacaacagagagtaatatagcaagagac
atggctagcccaagctctgttacaagtagtgaaagcatagagctgccccagaccacagtt
gaccacattctgaactccaataaatacgacaccccagaagcctccctacccctgaagaaa
aggcggttacaaacctacaaagatggagaggtcccagccactgaaagtggtttaccatcg
cagaaaatggtcgacctaaccactgacaaacaggaccaaaacaaggatcataacaggaaa
cagcaggtggacatctctaagactgggtcctcgggtatgtttgtgaatcctcagatgagt
ctaatgctactgaacgagatccaaatggccctccaccaagacgaggatggggacttgcct
ttacatattgctgtggcacaggaaaacatcgtgatggtccagaaatttgttcatctaatg
acaatatctggtaaaaacgtggacaaatacaacaaatcactacagactcctctacacctg
gccgtggagctgcagtttgaccaggcagtgtccgtcctcctgatggctggagccaacccc
tcactggtcaacaacgagggcgacagtgcagttcatctagccgtgaaacacaacactatc
aataacctagcactcatgctcatcaaaagtcagcacaaggcagatatcaatgccaggaat
tttgaaggtttagccccacttcatttggctgttattaaaaaccagatagaaatggtgaag
gttctgataaggtgtggtgctgatatcaatattcaggatggcaagagtgggaggacgcca
ttgtttcatgctgttgagggtaatcagttagctttagtcatgctgttcaggcaatgcaat
gccaacctggagctgactaactatgcaggcatcactgctttaatggctgcccaggccaag
ggtttctctgaggccagctctgtgttaatggtgggcctggaccccaaggccatcatagaa
cacaaggagaaagagaagatgatgatgcccaataaaaagatgccaataccaaggattcct
agtaaagctcatttgattgtacctgttaatcaaagaggcattaaaaaggaaagcaacagt
gaaaatgaaaccagttcacaaggaaatagtcaagagagtgaagatgtcaagcagaggatg
gaggaaaaaactgatactcagcaactgtatgaaagagctgtcatggaatttaaaatgaaa
agagaaattcaggacagtgaagtgggggcattagaaattgaccgtaaagaaattgtggaa
cagaaacctcttcagttaacagtaaatcttccagtgaaaaaagaaaaacaaaagcgaaac
aagcaaaagaaattaaagaaagaaattaagcaggacagtgatatagagatttcttctgag
gtagttgttcaaactgtccctcacaaagggcctgtgaactctgtggtggagaattcagag
tgtaaaactactttagaatccatgaataacacttctaaaactgttccagtaagtggtact
aatgctgctaaaccagtgagcacagcagagaatgtgactagcatcaatgctaggacggca
tccctactggcagcccacctcaaaagcatgaagaatgcactgactagcagcaaacatggt
tcctcgttcccactaaatctatcctgtgatggaaaggagactgtcaactttgaaacaacg
agtacgacgttatccaatggatcctag

DBGET integrated database retrieval system