KEGG   Crassostrea gigas (Pacific oyster): 105344389Help
Entry
105344389         CDS       T03920                                 

Definition
(RefSeq) aldehyde dehydrogenase, mitochondrial
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00010  Glycolysis / Gluconeogenesis
crg00053  Ascorbate and aldarate metabolism
crg00071  Fatty acid degradation
crg00280  Valine, leucine and isoleucine degradation
crg00310  Lysine degradation
crg00330  Arginine and proline metabolism
crg00340  Histidine metabolism
crg00380  Tryptophan metabolism
crg00410  beta-Alanine metabolism
crg00561  Glycerolipid metabolism
crg00620  Pyruvate metabolism
crg01100  Metabolic pathways
Module
crg_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105344389
   00053 Ascorbate and aldarate metabolism
    105344389
   00620 Pyruvate metabolism
    105344389
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105344389
   00561 Glycerolipid metabolism
    105344389
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105344389
   00310 Lysine degradation
    105344389
   00330 Arginine and proline metabolism
    105344389
   00340 Histidine metabolism
    105344389
   00380 Tryptophan metabolism
    105344389
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105344389
Enzymes [BR:crg01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105344389
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh MukF_C
Motif
Other DBs
NCBI-GeneID: 105344389
NCBI-ProteinID: XP_011450475
UniProt: K1QNT7
LinkDB All DBs
Position
Unknown
AA seq 519 aa AA seqDB search
MALFRCGLKFRALSAALRNNVACMSSLPQPIKNPEIKYNKVFINNDFVDSQSGKTFPTIN
PATGEVICQVAEGDKKDVDLAVKAAQDAFRLGSPWRRMDASERGVLLNKLADLIERDRVY
ITSLETLDNGKPYHVAFNADLNLVIKCYRYYAGWADKIEGKTVPVAGDFFAYTRREPVGV
CGQIIPWNFPLLMQAWKLGPALACGNVVVMKVAEQTPLTALYIAHLAREAGFPPGVINII
PGYGPTAGGAIASHMDVDKLAFTGSTEVGQIVAQAAAQSNLKRVTLELGGKSPNIVLADA
DMEQAVETSHFALYFNQGQCCCAGSRTFVEEKIYDEFVERSAERAKKRTVGNPFDLTNEQ
GPQVDQEQTDKIMSYIKSGKEQGAKLVAGGNKMGDKGYFIEPTVFADVKDEMKIAQEEIF
GPVQTILKFKDMDELIERCHKTIYGLAAAVQTKDLEKALHLSNTLRAGTVWVNCFDVFDA
SMPFGGYKMSGNGRELGEYGLEAYSEVKSVVIKIPQKNS
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atggcgttattcagatgtggacttaagtttagggcactctccgctgctctcagaaacaat
gttgcctgcatgtcatcgcttccccagccaattaagaaccccgaaatcaaatacaataag
gttttcatcaacaatgatttcgtagacagtcagtcggggaagacgttcccaacgattaac
ccagcaacaggggaggtcatttgtcaggttgctgaaggagataagaaagatgtagaccta
gcagtgaaggcagcccaagatgcttttcgattggggtcaccatggcgacgaatggatgct
tccgaaagaggtgttcttctcaataagctggcagacctgatagagagagacagagtctac
ataacatctttggaaacacttgacaatggtaaaccttatcatgttgcctttaatgctgat
cttaacctggtcatcaaatgttaccgctactacgccggctgggctgataaaatcgagggc
aagactgtgccagtggctggtgacttctttgcttacaccagacgtgaacccgtaggagtt
tgtggacagatcatcccgtggaacttccccctgctgatgcaagcctggaagctgggccct
gccctggcttgtggtaatgtggttgttatgaaggtcgcagagcagactcctctcaccgcc
ctctacattgctcacctggctagagaggctggattccctcccggtgttattaacatcatc
ccagggtatggccccactgcaggaggggctatcgccagtcacatggatgtcgacaagctg
gcgttcactggctccacagaggttggacaaatagtagctcaggcagctgcccagtccaac
ctgaaaagagttacccttgaactcggagggaaaagtcccaatattgttctggctgacgct
gatatggaacaggctgttgaaacatcccactttgccctgtatttcaatcaaggacagtgt
tgttgtgctggttcccgtacttttgtcgaggagaaaatctacgacgagtttgtggagagg
agtgcagagagggcaaagaaaaggactgtaggaaatccttttgatttgaccaatgaacag
ggaccccaggtggaccaagagcaaacagataaaatcatgtcgtacatcaagagtggaaaa
gaacaaggggccaaacttgtggcagggggcaacaagatgggggacaagggctacttcatt
gaacccacagtctttgcagatgtgaaggatgaaatgaaaattgcccaagaagagattttt
ggcccggtgcagaccattttgaagttcaaggacatggatgaactgattgagagatgtcac
aagacaatctatggactggctgctgctgttcaaaccaaggaccttgagaaagcactacac
ctctctaacaccttgagggctggcacagtctgggtgaactgttttgatgtgtttgatgcc
agcatgccttttggtggatacaaaatgtctggtaacgggagagagctgggagagtatgga
ttggaggcatactcagaagtcaaatccgttgtaatcaagattcctcagaagaattcctaa

DBGET integrated database retrieval system