KEGG   Crassostrea gigas (Pacific oyster): 105348620Help
Entry
105348620         CDS       T03920                                 

Definition
(RefSeq) metalloproteinase inhibitor 3-like
  KO
K16866  metalloproteinase inhibitor 3
Organism
crg  Crassostrea gigas (Pacific oyster)
Brite
KEGG Orthology (KO) [BR:crg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:crg01002]
    105348620
Peptidases and inhibitors [BR:crg01002]
 Peptidase inhibitors
  Family I35: timp family
   105348620
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIMP NTR
Motif
Other DBs
NCBI-GeneID: 105348620
NCBI-ProteinID: XP_011456443
LinkDB All DBs
Position
Unknown
AA seq 210 aa AA seqDB search
MKRLAIICVVLVCVFAYNEACSCIPTHPQEQFCNSDFVVRARILSRTVTGSTNLFDNVFY
TVLISQNYKGGTRIGSISQRIYTAPHSASCGVSFQIGRQYIIAGYIQNNRWRASLCSWNP
QTSSLSQLQRNALRYGYYRDNCYCNVRDCTFTSNPQCPVSRRNECWIRTNSDCFRRRNVC
IFNGRRCRWQYGACFAVSGLGLGLGLASGN
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactggcgattatttgcgtcgttttggtttgcgtctttgcctataacgaagct
tgttcatgtataccgactcatccccaagaacagttttgtaactcagatttcgttgtcaga
gcaaggattttgagtcggacggtaactggcagtacaaacttatttgacaatgtattctac
acggtgctgataagtcagaactacaagggaggaactcgaataggtagcatatcacaacgg
atatacactgctccccacagtgcttcctgtggcgtgtcatttcagattggtcgtcagtac
atcattgctggttatatccaaaacaatagatggagagcaagtttatgtagttggaaccct
caaacatcctcactttcccaattgcagagaaatgcactgagatatggttattatagagac
aattgttactgtaatgtcagagactgtacctttacaagtaaccctcaatgcccagtttca
agaaggaacgagtgttggatcagaaccaacagcgattgtttcaggaggcgaaatgtgtgc
atttttaacggaaggaggtgcaggtggcaatacggagcttgctttgcggtttcaggatta
ggattaggacttggattggcttctggaaattaa

DBGET integrated database retrieval system