KEGG   Crassostrea gigas (Pacific oyster): 109619416Help
Entry
109619416         CDS       T03920                                 

Definition
(RefSeq) maltase-glucoamylase, intestinal-like
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
crg  Crassostrea gigas (Pacific oyster)
Pathway
crg00052  Galactose metabolism
crg00500  Starch and sucrose metabolism
crg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:crg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    109619416
   00500 Starch and sucrose metabolism
    109619416
Enzymes [BR:crg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     109619416
    3.2.1.20  alpha-glucosidase
     109619416
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 DUF5110 Trefoil
Motif
Other DBs
NCBI-GeneID: 109619416
NCBI-ProteinID: XP_019924963
LinkDB All DBs
Position
Unknown
AA seq 964 aa AA seqDB search
MAATGRSNSGRHTCFMCILFMMSAAAIVMSALVLNRMLNDDDDESPRSTLSPDTAAGQKV
DSSTPQVPSPVPEFRTEAVVDCDPPNQRDPSRVDQEQCGQRQCKWIQHSHERAPRCVLTK
SVGYSLPGNVQAGPGSLSEARIVRKGPTKIYDRPVYKEVDVSVDEYGDNALRIFFRPVNS
SAFEIPDEALKINRPSPATNKKYKVEFVREPTFGIKVTRKSSNTVIFDSSLPGLTFSDQF
LQISTRLPTDNVYGFGEHNHRRYRHDMNWKTWGMFSRDFAPNDEPWNLYSVHPVYMNLES
DGQANMVFLKNSNAMEVTLQPSPYPAITYRTIGGVLDFYVFLGENPNHALQQYIQAIGRP
PMPPYWSLGFHICRWGYRDLPEMKKVHERNILAEIPFDTQWGDIDYMYKKFDFTYDKTTF
ASLPQFVEQVHNRGKKFVVIVDSGIGANKTLYAEARSNSSGYSMYDDAVQRDVLVKNATG
DILIGKVWPGQSVFPDFTNVNKITDFWARWIKFFVKNESIPADGLWIDMDEPASFIPGSE
NGCQRNDWNNPPFIPKIKDGEKDGGSLYYKTLCMDAQQNWGRHYDVHSMYGHSESMVTYR
ALTKLYPNKRPFIVTRSSFAGTSQYASTWLGDNDGQWSHMHDSIVGMLEYQMFGFPMVGA
DICGFFGADQREMCLRWYQLATFYPFARSHNGIYSPHNSSFVPDQDPAFWDPDFVRIVRN
HLLLRYKFLPYMYTCFKEAHVDGKMVLRSLMFEFPTDPNTWAIDQQFMFGSSILVSPVLE
ENKKTVDAYIPKGRWYTYNGDNEVNSWNGQNYTLDAPLHVLNFHAKGGSIIPMQDPGNST
HYSRMNPMGLWCALDESNSASGSLFMDDGESIDSIARKNYLELRFTLQKGRQLDINVMHG
GYTPPGNLSFTSVEISGLSVFPTSVYIDGIKMDASHIRLKRKILQFVDISLAVNKNHTIT
WNPF
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atggcggccaccgggcgctccaactcgggcagacatacttgttttatgtgcatactgttc
atgatgtcggctgccgctatagtcatgtcggcattggttcttaatcgaatgttgaacgac
gacgacgacgaatcgccccggtctactctatcgccggacacggccgctggtcagaaagtg
gactcctctaccccccaggttcccagccccgtgccagagtttaggacggaggccgtggtg
gattgtgaccctcccaatcagagggatccgtcgcgtgttgaccaggaacaatgcggacaa
aggcagtgcaaatggatccaacattctcatgaaagagccccaaggtgcgtgttaacgaaa
tctgttggatattcacttccgggaaacgtccaggccggtcccggctccctgtccgaggcg
cggatagtgaggaaaggtcccacgaagatctatgataggcctgtctacaaagaagtggat
gtttccgtagatgaatacggggacaatgctctcaggatcttttttcgcccagtcaactca
tctgcctttgagattccggacgaggcgctcaaaataaaccgaccgtctcccgccaccaac
aagaaatacaaagtagaatttgtaagagaaccgacgtttggtatcaaagttaccaggaaa
agctcaaacacagtaatctttgacagcagtttgccgggactgacgttctctgaccagttc
ctgcagatcagcacccgcctccccacagacaatgtgtatgggtttggagagcacaaccac
aggcgctaccgccatgacatgaactggaaaacgtggggcatgttctcgagggattttgct
ccgaatgacgagccgtggaatctgtacagcgttcatcctgtttatatgaatctggaatca
gacggacaggcaaacatggtgtttctcaaaaacagcaatgcaatggaggtgaccctgcag
ccgtccccgtaccccgccattacctacagaacaataggaggggttctagatttctacgtg
ttcctgggggagaacccaaaccacgcccttcagcagtacatacaggcgataggtcgccct
cctatgccgccctattggtctcttggtttccacatctgtagatggggatatcgagactta
ccggaaatgaagaaagttcacgagaggaatattctggcagaaataccgtttgacacacag
tggggagacattgactacatgtacaaaaagtttgatttcacctacgacaaaaccaccttt
gcgagtctaccacaatttgtggaacaggtccataacagggggaagaaatttgtggttatt
gtggactccggtattggagccaacaaaacactgtatgccgaggctagaagtaacagttcc
ggatatagcatgtatgatgacgcagtgcagagagatgtactggtgaaaaacgccaccgga
gatatcctgatcggaaaggtttggcctggtcaaagtgttttcccagacttcacaaacgtc
aacaaaattacggacttctgggcccgctggataaagttctttgtgaaaaacgaatccatc
ccggccgacgggttatggatagatatggacgagcctgcaagcttcatcccgggatctgag
aatggttgccagagaaatgattggaacaacccgccgtttattccaaaaataaaagacgga
gagaaagatggtggaagtttgtattacaagaccttgtgtatggacgcacagcaaaactgg
ggcagacattacgacgttcacagtatgtacgggcatagtgagagcatggttacttacaga
gccctgaccaagctgtaccctaacaagagacccttcattgtgactcggtcctccttcgcc
ggaacctcccagtacgcttccacgtggctgggggacaacgacggacagtggagtcacatg
cacgactccattgtggggatgctggaatatcaaatgtttggctttcctatggtaggagca
gatatctgcgggtttttcggagctgaccagcgtgagatgtgcctaagatggtaccaactt
gcgaccttctacccatttgcaaggagtcataacgggatttatagcccacataacagcagt
tttgtaccggaccaggacccggcgttttgggacccagattttgtccgcattgtgcgtaac
catctactgcttcgatataagttcttaccgtacatgtacacgtgcttcaaagaggcgcac
gtggacgggaaaatggttctacggtccctgatgtttgagtttccaacagatcccaacacg
tgggctatcgaccaacagttcatgttcggatcctcaattcttgtgtctcccgttttagaa
gaaaacaagaagacagttgatgcgtatattccaaaaggaaggtggtacacttacaatggg
gacaatgaggtaaattcttggaatggtcagaactacactctggacgcgcctctccacgtg
ctgaatttccacgccaagggaggatctattatcccgatgcaagacccagggaactccact
cattatagtcgtatgaatccgatgggtctgtggtgtgccttggacgaaagcaacagcgct
agtgggtctttatttatggacgatggcgaaagcatagattctatcgcaaggaaaaactat
cttgagctgcgctttaccctgcagaaggggagacaactcgatataaatgtgatgcatggc
ggatacactcctcccggaaatctgagtttcactagcgtggaaatctcaggtctctccgtc
ttcccgacctcagtctacattgacggaataaagatggacgccagtcatatccggctgaaa
agaaaaattctacagttcgtcgacataagtttggctgtaaacaagaatcacactataacg
tggaacccattttga

DBGET integrated database retrieval system