KEGG   Citrobacter rodentium: ROD_04271Help
Entry
ROD_04271         CDS       T01145                                 

Gene name
phoA
Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
cro  Citrobacter rodentium
Pathway
cro00730  Thiamine metabolism
cro00790  Folate biosynthesis
cro01100  Metabolic pathways
cro02020  Two-component system
Module
cro_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    ROD_04271 (phoA)
   00790 Folate biosynthesis
    ROD_04271 (phoA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ROD_04271 (phoA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cro04147]
    ROD_04271 (phoA)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cro00537]
    ROD_04271 (phoA)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     ROD_04271 (phoA)
Exosome [BR:cro04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ROD_04271 (phoA)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:cro00537]
 Enzymes
  ROD_04271 (phoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Phosphodiest Sulfatase
Motif
Other DBs
NCBI-ProteinID: CBG87208
UniProt: D2TKW7
LinkDB All DBs
Position
478464..479879
Genome map
AA seq 471 aa AA seqDB search
MKQSAMIFALLPLLLAPASQADTTTISVLDNRAAQGDITTPGGARRLTGDQTAALRESLN
DKPAKNIILLIGDGMGDSEITAARNYAEGAGGFFKGIDALPLTGQYTHYALNKKTGKPDY
VTDSAASATAWSTGVKTYNGALGVDIHEKDHLTILEMAKAAGLATGNVSTAELQDATPAA
LIAHVTSRKCYGPTATSEKCPTNALEKGGKGSITEQLLNARADVTLGGGAKTFAETATAG
EWQGKTLREQAQMRGYQLVGDAASLAAIDEANQDKPLLGLFAEGNMPVRWEGPKASYHGN
IDKPAVTCTPNPKRNDAIPTLAQMTDKAIELLSKNERGFFLQVEGASIDKQDHAANPCGQ
IGETVDLDEAVQRALAFAKKDGNTLVIVTADHAHASQIVAPETKAPGLTQALNTKDGAVM
VISYGNSEEDSQEHTGSQLRIAAYGPHAANVVGLTDQTDLFYTMKAALGLK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaaagcgctatgatttttgccttgctgcctttgctgttggctccggccagtcag
gcggacaccacaacaatatccgtgctggataatcgtgcggcgcagggcgatattactacg
cccggcggcgcgcgccgattaaccggcgatcaaacggcggcgctgcgtgaatcgctaaat
gataaaccggcgaaaaatattattctgctgatcggcgacggaatgggagattctgaaata
accgccgcacgaaattatgccgaaggcgccggcggcttttttaaaggtattgatgccctg
ccgctgaccggacaatatacccactatgcgctgaataaaaaaaccggcaaaccagattac
gtgaccgattccgccgcctcagccaccgcgtggtccacaggggtgaaaacctacaacggc
gcgctgggggtcgatattcatgaaaaagatcatctgaccattctcgaaatggcgaaggcc
gcaggtctggctaccggcaacgtctcgaccgcggagttgcaggacgccaccccggcagcg
ctgattgcccatgtcacctcgcgcaaatgctatggcccgacggcgaccagcgaaaaatgt
ccgacaaacgcgctggaaaagggcggcaaaggctcgattactgaacagctcctgaacgcg
cgggcggacgtcaccctgggcggcggcgcgaaaaccttcgccgagacggcaaccgccggc
gagtggcaggggaaaacgctgcgtgagcaggcgcagatgcgcggctaccagttagtcggc
gatgccgcctctttagcggcgatcgacgaagcgaatcaggacaaaccgctgctgggactg
ttcgcagaggggaatatgccggtgcgctgggaagggccgaaggcctcgtaccacggcaat
attgataaacctgccgtgacctgtacgccaaatccgaaacgcaatgacgcgattcccacg
ctggcgcagatgaccgacaaagccatcgaactgttgagcaaaaatgagcggggcttcttt
ttacaggtggaaggcgcgtctatcgataagcaggatcacgccgcgaacccgtgcggacag
attggcgagacggtggatcttgatgaagccgtacagagggcgctggcctttgcgaagaaa
gacggcaatacgctggtgatcgttaccgccgatcatgctcatgccagccagatcgtggcg
cccgaaacgaaagcgccggggctgacgcaggcgctgaacaccaaagatggcgcggtgatg
gtcatcagctacggcaactcggaagaagattcccaggagcataccggcagccagctgcgc
atcgccgcttacgggccgcatgcggcgaacgtggtcgggctgaccgatcaaaccgatctg
ttctacaccatgaaagcggcgctgggcctgaagtaa

DBGET integrated database retrieval system