KEGG   Citrobacter rodentium: ROD_07221Help
Entry
ROD_07221         CDS       T01145                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
cro  Citrobacter rodentium
Pathway
cro00020  Citrate cycle (TCA cycle)
cro00190  Oxidative phosphorylation
cro00650  Butanoate metabolism
cro01100  Metabolic pathways
cro01110  Biosynthesis of secondary metabolites
cro01120  Microbial metabolism in diverse environments
cro01130  Biosynthesis of antibiotics
cro01200  Carbon metabolism
Module
cro_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cro_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cro_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ROD_07221 (sdhB)
   00650 Butanoate metabolism
    ROD_07221 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ROD_07221 (sdhB)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ROD_07221 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     ROD_07221 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_18 Fer4
Motif
Other DBs
NCBI-ProteinID: CBG87498
UniProt: D2TPC9
LinkDB All DBs
Position
793740..794456
Genome map
AA seq 238 aa AA seqDB search
MRLEFSIYRYNPDVDDAPRMQDYTLEAEEGRDMMLLDALIQLKEKDPSLSFRRSCREGVC
GSDGLNMNGKNGLACITPISALNQLGKKIVIRPLPGLPVIRDLVVDMGQFYAQYEKIKPY
LLNNGQNPPAREHLQTPEQREKLDGLYECILCACCSTSCPSFWWSPDKFIGPAGLLAAYR
FLIDSRDTETDSRLEGMSDAFSVFRCHSIMNCVSVCPKGLNPTRAIGHIKSMLLQRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgagactcgagttttcaatttatcgctataacccggatgttgacgacgctccgcgcatg
caggattacaccctcgaagcggaagaagggcgcgacatgatgctgctggatgcgttaatc
cagctgaaagagaaagatccgtcgctgtcgttccgccgctcctgtcgtgaaggggtgtgc
ggttccgatggcctgaacatgaacggcaaaaacggcctggcgtgcatcacgccgatttcg
gcgctcaatcagctgggtaagaaaattgtcattcgtccgctgcccggtttgccggtaatc
cgcgatttggtggtagacatggggcaattctacgcacaatatgagaagattaagccttac
ttgttgaataatgggcaaaatcctccagcgcgtgagcatttgcagacgccggaacagcgg
gaaaaactggacgggctgtacgagtgcattttgtgcgcctgttgctccacctcctgcccg
tctttctggtggagcccggacaagtttatcggcccggccggtctgttagcggcctatcgc
ttcctgatcgacagtcgcgataccgaaaccgacagccgtctggaaggcatgagcgatgca
ttcagcgtattccgctgtcacagcatcatgaactgcgtcagtgtttgtccgaaagggctg
aacccgacgcgcgctatcggccatattaagtcgatgctgttgcagcgcagcgcgtaa

DBGET integrated database retrieval system