KEGG   Citrobacter rodentium: ROD_08081Help
Entry
ROD_08081         CDS       T01145                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K06970  23S rRNA (adenine1618-N6)-methyltransferase [EC:2.1.1.181]
Organism
cro  Citrobacter rodentium
Brite
KEGG Orthology (KO) [BR:cro00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:cro03009]
    ROD_08081
Enzymes [BR:cro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.181  23S rRNA (adenine1618-N6)-methyltransferase
     ROD_08081
Ribosome biogenesis [BR:cro03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ROD_08081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_10 MTS Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: CBG87585
UniProt: D2TQB9
LinkDB All DBs
Position
889932..890942
Genome map
AA seq 336 aa AA seqDB search
MSASPQKPGLHPRNRHHSRYDLPALCKGTPELSQYLIRTPAGEQSVDFASPQAVRALNKA
LLAHFYGVANWDIPDGFLCPPVPGRADYIHHLADLLAETAGSVPTNASILDIGVGANCIY
PLIGVHEYGWRFTGSETNEQALASAQAIISANPGLTRAIRLRRQKTPAAIFNGIIHKNEQ
YDATLCNPPFHDSAASARAGSERKRRNLGQDKDEALNFGGQQQELWCEGGEVAFIKTMIA
ESRAFGRQVMWFTTLVSRGENLPPLYRALTDIGAVKVVKKEMAQGQKQSRFIAWTFMDDD
KRRHFQARKRYSVGSAGGCGAGAEGIVAESVGAGRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcgtccccccagaaaccgggtttacacccgcgtaatcgtcaccacagccgctac
gatctgcccgcgctctgcaagggcacgcctgaattgtcgcaataccttatccgtactccg
gctggggaacagagcgtcgattttgccagccctcaagcggtcagggcgttgaataaagcg
ctgctggcgcatttctacggggtagcgaactgggatattcctgacggctttttatgtccg
ccggtgccggggcgggcggattatattcaccatctggccgatctgcttgcggaaaccgcg
ggtagcgtgccgacaaatgcctccattctggatattggcgtcggcgctaactgtatttat
ccgcttattggcgttcatgaatatggctggcgctttaccggcagcgagacgaacgagcag
gcgttagccagcgcccaggccattatcagtgccaatcctggcctgacgcgcgcgattcgc
ctgcgtcgtcagaaaacgcccgcggcgatttttaacggcattattcataaaaatgagcag
tatgacgccacgctgtgcaatccgccgttccacgattcggcggcctccgcgcgcgccggc
agcgagcgtaaacgccgcaatctcgggcaggataaagacgaggcgctgaattttggcggc
cagcagcaggagctgtggtgcgaaggcggggaagtggcctttatcaaaaccatgattgcc
gaaagccgcgcctttggccgccaggtgatgtggtttaccaccctcgtatcacgcggagaa
aacctgccgccgctgtaccgcgcgctcactgatatcggcgcggtaaaggtggtcaaaaaa
gagatggcccaggggcaaaagcagagtcgctttattgcctggacctttatggatgacgac
aagcgtcgccattttcaggcgcgtaaacgctatagcgtcggttcggcgggcggctgcggc
gctggcgcggaaggtatcgtcgctgaaagcgtcggcgcaggcaggagctga

DBGET integrated database retrieval system