KEGG   Citrobacter rodentium: ROD_14321Help
Entry
ROD_14321         CDS       T01145                                 

Gene name
gst
Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
cro  Citrobacter rodentium
Pathway
cro00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:cro00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ROD_14321 (gst)
Enzymes [BR:cro01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ROD_14321 (gst)
Transporters [BR:cro02000]
 Other Transporters
  Pores ion channels [TC:1]
   ROD_14321 (gst)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_C GST_C_3 GST_C_2 GST_N_2 GST_N GST_N_3 GST_C_6 Glutaredoxin2_C Tom37
Motif
Other DBs
NCBI-ProteinID: CBG88195
UniProt: D2THK1
LinkDB All DBs
Position
complement(1530766..1531371)
Genome map
AA seq 201 aa AA seqDB search
MKLFYKPGACSLASHITFRESGKDFTLDGVDLMKKRLENGDDFLAVNPKGQVPALLLDDG
TLLTEGVAIMQYLADSVPDRQLLAPVNSISRYKTLEWLNYIATELHKGFTPLFRPDTPEE
YKPTVRALLEKKLQYVDDVLKDEPWICGQRFTIADAYLFTVLRWAYAVKLKMEGLAHIAD
YMTRVAERPAVAAALKAEGLQ
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgttctataagccgggcgcctgttccctcgcctcccacattacctttcgcgag
agcggaaaagatttcactcttgacggcgttgacctgatgaaaaagcgcctcgaaaacggc
gatgattttctggcggtgaacccaaagggacaggttcccgcactgctgcttgatgacggc
acgctgctgaccgaaggcgtagcgatcatgcagtaccttgcggacagcgtgccggatcgt
cagctgctggcgccggttaacagcatttcacgctacaagacgcttgagtggctgaactac
attgcgaccgagctgcacaaaggctttacgccgctgtttcgccccgatacgccggaggag
tacaagcccaccgtgcgcgcgctactggagaagaagctacagtatgttgatgacgtcctg
aaagacgaaccgtggatttgcggtcagcgctttaccatcgcagacgcctatctgtttacc
gttctgcgctgggcttatgcggtgaagctgaagatggaaggactggcgcatattgccgac
tatatgacgcgagtggcggaacggcctgcggttgccgcagcgctgaaagcggaggggtta
cagtaa

DBGET integrated database retrieval system