KEGG   Citrobacter rodentium: ROD_17691Help
Entry
ROD_17691         CDS       T01145                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
cro  Citrobacter rodentium
Pathway
cro00240  Pyrimidine metabolism
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    ROD_17691 (tdk)
Enzymes [BR:cro01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     ROD_17691 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30
Motif
Other DBs
NCBI-ProteinID: CBG88526
UniProt: D2TL77
LinkDB All DBs
Position
complement(1878374..1879000)
Genome map
AA seq 208 aa AA seqDB search
MAQLYFYYSAMNAGKSTALLQSSYNYQERGMRTVVYTAEIDDRYGAGKVSSRIGLSSPAK
LFNQDSSLYAEIAADNAAQPIHCVLVDECQFLTRQQVYELSEVVDQLDIPVLCYGLRTDF
RGELFVGSQYLLAWSDKLVELKTICFCGRKASMVLRLDQSGRPYNEGEQVVIGGNERYVS
VCRKHYKEALEEGSLTAIQERHRHDRSC
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagctatatttctactactcagcaatgaatgcaggtaagtcgaccgccttactg
caatcttcttacaattatcaggagcgcgggatgcgcaccgtcgtatatacggcggaaata
gatgaccgctacggcgcgggaaaagtgagttcacgtataggactgtcatcacccgccaaa
ttatttaaccaggattcatctttgtatgctgagatcgccgccgataacgcggcccagcca
atacactgcgtgctggtggacgaatgtcagtttttaacccgccaacaggtctatgaatta
tctgaggttgttgatcaactggatataccggtgctgtgctacggtttgcgcaccgacttt
cgcggagagctgtttgtcggtagccagtatctgctggcctggtcagataagctggttgaa
ttaaaaaccatctgcttctgcggacgtaaagcgagtatggtactgcgtctcgaccagtca
ggcagaccctataacgaaggcgaacaggtggttataggcggcaacgagcgctacgtttcg
gtatgccgtaagcattataaggaagcgctggaggagggatctctgacggcgatacaggaa
cgtcatcgtcacgatcgatcctgctga

DBGET integrated database retrieval system