KEGG   Citrobacter rodentium: ROD_20111Help
Entry
ROD_20111         CDS       T01145                                 

Gene name
amyA
Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
cro  Citrobacter rodentium
Pathway
cro00500  Starch and sucrose metabolism
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ROD_20111 (amyA)
Enzymes [BR:cro01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ROD_20111 (amyA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939 Malt_amylase_C ERbeta_N
Motif
Other DBs
NCBI-ProteinID: CBG88763
UniProt: D2TNR9
LinkDB All DBs
Position
2118906..2120393
Genome map
AA seq 495 aa AA seqDB search
MKNPTLLQFFHWYYPDGGRLWQEVAERADGLNDIGINMVWLPPACKGASGGYSVGYDCYD
LFDLGEFDQKGSVATKYGDKQQLLAAIDSLKRNQIAVLLDVVVNHKMGADEKEAIRIQRV
NEDDRNQIDDHIIDCEGWTRYTFPARAGKYSQFIWDYKCFSGIDHIENPTEDGIFKIVND
YTGEGWNDQVDDEMGNFDYLMGENIDFRNRAVTEEIKYWARWVMDQTHCDGFRLDAVKHI
PAWFYREWIEHVQEVAPEPLFIVAEYWSHDVDTLQNYINQVEGKTMLFDAPLQMKFHEAS
RQGREYDMRQIFSGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDTGDDGGTYPIDMPVIEQLDQLILARQRFAHGVQTLYFDHPNCI
AFSRSGTEDDPGCVVVLSNGDDGEKTLALGANYGNKTWRDYLGNRDERVVTDENGEATFY
CNGGSVSVWVIEEAI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatcccactttattgcagttcttccactggtattaccccgacggcggcaggctc
tggcaggaagttgccgagcgcgcggacgggctcaatgatatcggtattaatatggtctgg
ctgcctccggcgtgtaaaggcgcatcgggcggctattctgtcggctacgactgctatgac
ctatttgatctgggcgaatttgatcaaaaaggatcggtcgccaccaaatatggcgacaaa
caacagctgctggcggcgatcgactcgctgaaacgaaaccagattgcagtgctgctcgac
gtggtggtaaaccacaaaatgggcgccgacgaaaaagaagcgattcgcatccagcgggtc
aacgaagacgatcgtaatcagattgatgaccacatcatcgactgcgaaggctggacgcgc
tacaccttccctgcccgcgccgggaaatattcgcagtttatctgggattacaaatgtttc
agcggtatcgaccacattgaaaaccccaccgaggacggcatctttaaaatcgtcaacgac
tataccggcgaaggctggaacgatcaggtcgacgatgagatgggcaactttgactacctg
atgggcgaaaatatcgatttccgcaaccgcgccgtgacggaggagatcaaatactgggcc
cgctgggtgatggatcaaacccactgcgacggcttccgtcttgatgcggtaaagcacatt
ccggcctggttttacagggagtggatagaacacgtgcaggaggtcgcgccagagccgctg
tttatcgtcgcggaatactggtcgcatgatgtcgatacgctgcaaaactacattaatcag
gtagaagggaaaacgatgctgtttgacgcccctctgcagatgaagtttcatgaggcctcc
cgccaggggcgcgagtacgatatgcggcagatcttcagcggtacgctggtggaggccgat
ccgtttcatgcggtaacgctggtcgccaaccacgatacccagccgctgcaggcgctggaa
gcgccggttgagccttggtttaaaccgctggcctacgcgctgatcctgctgcgggaaaac
ggcgtgccctccgtattctatcccgatctctacggcgcgcactatgaagataccggcgac
gatggcggcacctatcccatcgacatgccggtgattgagcagcttgaccagcttattctc
gcccgtcagcgtttcgctcacggcgttcagacgctctattttgaccatcccaactgcatc
gccttcagccgcagcggcacagaagacgatcccggctgcgtggtggtgctttccaacggc
gatgatggcgaaaagacccttgcgcttggcgcaaactacggcaataaaacctggcgcgac
tatctcggcaaccgtgatgagcgcgtggtcactgacgagaacggcgaagcgacattttac
tgcaacggcggcagcgtcagcgtatgggtaattgaagaggcaatatag

DBGET integrated database retrieval system