KEGG   Citrobacter rodentium: ROD_21151Help
Entry
ROD_21151         CDS       T01145                                 

Gene name
cbiT
Definition
(GenBank) probable cobalt-precorrin-6Y C(15)-methyltransferase [decarboxylating]
  KO
K02191  cobalt-precorrin-6B (C15)-methyltransferase [EC:2.1.1.196]
Organism
cro  Citrobacter rodentium
Pathway
cro00860  Porphyrin and chlorophyll metabolism
cro01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ROD_21151 (cbiT)
Enzymes [BR:cro01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.196  cobalt-precorrin-6B (C15)-methyltransferase [decarboxylating]
     ROD_21151 (cbiT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MTS Methyltransf_31 GidB Cons_hypoth95 PrmA PCMT Methyltransf_25 Methyltransf_4 Methyltransf_12 Methyltransf_11 Methyltransf_2 Met_10 Methyltransf_23 Methyltransf_18 CMAS Methyltransf_5 RrnaAD Methyltransf_16 Methyltr_RsmB-F DOT1 Methyltransf_3
Motif
Other DBs
NCBI-ProteinID: CBG88865
UniProt: D2TPP8
LinkDB All DBs
Position
complement(2216533..2217087)
Genome map
AA seq 184 aa AA seqDB search
MKDELFLRGEKVPMTKEAVRALALHRARHLIDIGAGTGSVSIEAALQYPQLRVTAIERNP
AALRLLDENRQHFACPNIEILPGEAPMVITEKADAVFMGGSGGQLPELIDWSLRQLHPGG
RLVMTFILQENLNAALAHLQLAGVEDIDCLQLQISSLTALGSGHYFKPNNPVFVVACQKE
ERYV
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgagctttttctgcgcggcgagaaggtgccgatgaccaaagaggcggtacgc
gcgctggcgctgcaccgggcccgccatctgattgatatcggggccgggaccggcagcgtt
tccatcgaagcggcattgcagtacccgcagctgcgcgtcaccgccattgaacgcaatccg
gcggcgctgcggctgcttgatgagaatcgccagcattttgcctgcccgaatattgagatc
ctgccgggagaagcgccgatggtgataacggaaaaagccgacgcggtgtttatgggcggc
agcggtggtcagttgccggaacttatcgactggtcgctgcgccagctgcatcccggtggg
cgtctggtgatgacctttatccttcaggaaaaccttaacgccgcgctggcgcatctacag
ctggcgggcgtagaggatattgactgcctgcaactgcaaatttcgtccctgaccgcgctc
ggcagcggtcactatttcaaaccgaacaatcctgtttttgtcgtcgcctgtcagaaggaa
gaacgctatgtctga

DBGET integrated database retrieval system