KEGG   Citrobacter rodentium: ROD_26531Help
Entry
ROD_26531         CDS       T01145                                 

Gene name
glpA
Definition
(GenBank) anaerobic glycerol-3-phosphate dehydrogenase subunit A
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
cro  Citrobacter rodentium
Pathway
cro00564  Glycerophospholipid metabolism
cro01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ROD_26531 (glpA)
Enzymes [BR:cro01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ROD_26531 (glpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO Fer2_BFD FAD_binding_2 FAD_binding_3 DAO_C FAD_oxidored Pyr_redox_2 Thi4 3HCDH_N HI0933_like NAD_binding_8 SO_alpha_A3 Pyr_redox_3 Lycopene_cycl FtsA GIDA Pyr_redox
Motif
Other DBs
NCBI-ProteinID: CBG89397
UniProt: D2TGZ2
LinkDB All DBs
Position
2801569..2803197
Genome map
AA seq 542 aa AA seqDB search
MNTRDSQTSDVIIIGGGATGAGIARDCALRGLRVILVERHDIATGATGRNHGLLHSGARY
AVTDAESARECISENQILKRIARHCVEPTDGLFITLPEDELSFQSTFIRACEEAGIRAEA
IDPQQARIIEPSVNPQLIGAVKVPDGTVDPFRLTAANMLDAKEHGAIILTAHEVTGLIRE
GATVSGVYVRNHLSGETQTLRAPVVVNAAGIWGQRIAEYADLNIRMFPAKGSLLIMDHRI
NQHVINRCRKPSDADILVPGDTISLIGTTSTHIDYNEIDSNRVTADEVDILLREGEKLAP
VMAKTRILRAYSGVRPLVASDDDPSGRNVSRGIVLFDHAERDGMEGFITITGGKLMTYRL
MAEWATDAVCRKLGNSRPCVTADTPLPGSHEPTETTLKRVISLPAPLRGSAVYRHGDRTP
AWLSQGRQHRSLVCECEAVTAGEVQYAVENLNVNSLLDLRRRTRVGMGTCQGELCACRAA
GLLQRFNITTAAQSISQLSDFLNERWKGVQPIAWGDALRESEFTRWVYQGLCGLEKEPRD
EI
NT seq 1629 nt NT seq  +upstreamnt  +downstreamnt
atgaatactcgcgactcgcaaaccagtgacgtgattatcattggcggaggcgctacaggc
gctggtatcgctcgcgactgcgcgctgcgcgggctgcgtgttatcttagttgagcgccat
gatatcgccaccggcgcgaccggccgtaaccacggtctgctgcacagcggcgcacgctat
gcggtaactgacgcggaatcggcgcgcgaatgcatcagcgaaaaccagatcctcaaacgt
atcgcccgtcactgcgtggagccaaccgacggcctgtttattaccctgccggaagatgag
ctttcttttcagtccacctttattcgcgcctgcgaagaggcggggatccgcgccgaagcg
atcgatccgcaacaggcgcgcattatcgaaccgtcggttaacccacagctgatcggcgcg
gtcaaagtgcctgacggcaccgtcgatccgtttcgtctcaccgctgcgaacatgctggat
gcgaaagaacacggagccattattctcaccgcccatgaggtcaccggattaatccgcgaa
ggcgcaacggtgagcggcgtatacgtgcgcaaccatctcagcggcgaaacccagaccctg
cgcgctccggtagtggtgaacgccgccggtatctggggacagcggattgcggaatatgcc
gacctgaacatccgcatgttcccggcgaaagggtcgctgctgatcatggatcaccgaatc
aatcagcacgttatcaaccgctgccggaaaccatccgacgccgatattctggtgcccggt
gataccatttcgctgattggcaccacctccacgcacattgattacaacgagatcgacagc
aaccgcgtcaccgcagacgaagtggatattctgctgcgcgaaggggaaaaactggcgccg
gtaatggcgaagacccggatcctgcgcgcctactccggcgtgcgcccgctggtcgccagc
gacgacgatccgagcggacgtaacgtcagtcgcggcatcgtactgttcgatcacgccgag
cgcgacgggatggaggggtttatcaccatcaccggcggtaaactgatgacctaccggctg
atggcggaatgggctaccgatgcggtctgtcgcaaactgggcaatagccgcccctgcgtc
accgctgatacgccgctgcccggctcgcacgaaccgacggaaacgacgcttaagcgcgta
atttccctgcccgcgccgctgcgcggttccgccgtctatcgtcacggcgatcgtacaccc
gcctggttaagccaggggcgtcagcaccgtagcctggtctgcgaatgtgaagccgtcacc
gcaggcgaggtgcagtacgcggtggaaaacctgaatgtaaacagtctgctcgacctgcga
cgtcgcacccgcgtggggatgggcacctgccagggcgaactctgcgcctgccgcgccgcc
ggtctgctgcaacgctttaatatcaccaccgccgcgcaatccatcagtcaactttctgac
ttccttaatgagcgctggaaaggcgtacagccgattgcctggggcgacgcactgcgcgaa
agcgaatttacccgctgggtgtatcagggattatgtggactggaaaaggagccgcgcgat
gagatttga

DBGET integrated database retrieval system