KEGG   Citrobacter rodentium: ROD_29681
Entry
ROD_29681         CDS       T01145                                 
Symbol
espG
Name
(GenBank) T3SS effector protein EspG
  KO
K12785  LEE-encoded effector EspG
Organism
cro  Citrobacter rodentium
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
SSDB
Motif
Pfam: EspG
Other DBs
NCBI-ProteinID: CBG89704
UniProt: D2TKD5
LinkDB
Position
3144281..3145477
AA seq 398 aa
MILVIKIFVIDETERAFMLNGLNNNSASLVLDATIKINSDYKKPWNEMTCAEKLLKILTL
GLWNPKYSQDERQQFQGLLTVLEPVSPAHNELGRVYAKFSDGSSLRISVTNSELIEAEIH
TPNNEKFLVLLEANEQNRLLQSLPINRHMPYIQVHHTLPQEELTDLLSMHKLLSFTSKLS
ATLIPHNNQTDPLSGLTPFSTVFMDTSRGLGNSKLSLNGVDIPADAQKLLRNTLGLKDTN
SSPDLNVIRNGIPRHYAEQIVKESSSTNEQKAAVVDFLCQPEAPTAICSAFYQSFNVPAL
MLTHVRISQASAYNAQRSLDMPNACINISITQSSEGSIHVTSHTGVLIMAPEDRPNQLGM
LTNRTSYEVPPGVKCEPNEMARMLKAKYASSETYLNNA
NT seq 1197 nt   +upstreamnt  +downstreamnt
atgatactcgttatcaagatattcgtaattgatgaaacagagagagctttcatgttaaac
ggacttaataataattccgcatctttagttttagatgctacaattaaaattaactctgat
tataaaaagccgtggaatgagatgacatgtgcagaaaaattgctaaaaattctcactttg
gggttatggaatccaaagtattctcaggatgaaagacaacaatttcaagggttgttaacc
gttttagaacctgtatctcccgctcacaatgaattaggcagagtatatgcgaaattttca
gatggctcatccttaagaatttccgtcactaacagcgaactcattgaagcagagattcac
acgccgaataatgaaaagtttcttgtactcctggaggcaaacgaacaaaatcggctatta
caatctttacccatcaatcgccacatgccatacattcaggttcatcataccttacctcag
gaggaactgactgatcttctgtcaatgcacaaactacttagttttacttccaaattatca
gcaactttgattcctcataataatcaaacagatccgctttctggacttacgccattcagc
actgtgtttatggatacgtctcggggactcggcaattcaaagctttcactcaatggtgtt
gatatacctgcagatgcacaaaaattgcttcgcaatacgctagggcttaaagacacaaat
tcatcccctgatctaaatgttattaggaatggtattcctcgtcattatgcagaacaaatc
gtaaaggaaagcagcagtaccaatgagcagaaagctgcagttgtggattttttatgtcag
cccgaagcgccaactgccatatgctcggctttctatcagtccttcaatgttccagcctta
atgttgacacatgtaaggatctctcaagctagtgcatataatgcacaaagatcgttagat
atgcctaatgcttgtattaacataagcatcactcaatcatcagagggaagcattcacgtt
accagccatactggagttttaatcatggcgccagaggaccgtcccaaccaattagggatg
ttgacgaacagaacctcttatgaggtgccgccaggtgtgaaatgtgaacctaatgagatg
gcaaggatgttaaaagcaaaatatgcctcatctgaaacatatctgaacaatgcttaa

DBGET integrated database retrieval system