KEGG   Citrobacter rodentium: ROD_29701Help
Entry
ROD_29701         CDS       T01145                                 

Gene name
espF
Definition
(GenBank) T3SS effector protein EspF
  KO
K12786  LEE-encoded effector EspF
Organism
cro  Citrobacter rodentium
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EspF PDZ_1
Motif
Other DBs
NCBI-ProteinID: CBG89706
UniProt: D2TKD7
LinkDB All DBs
Position
complement(3146881..3147786)
Genome map
AA seq 301 aa AA seqDB search
MLNGIGQAVSTLGRQLANVASRVGSVGGASFSVSPQAVRLTTIRIQSPFSPAVSHINART
NFNVSGVTTSLTPSRPAPSPPTSGQSTGRSQSLPPIAQALKDHLAAFEASKSLEASSLKP
ARPAPQSPTNGQSTGRSQSLPPIAQALKDHLAAFEASKSLEASNLKPARPAPQPPTNGQS
TGRAQSLPPIAQALKDHLAAFEASKSLEASSLKPARPAPQPPTSGQSTGRSQSLPPIAQA
LKDHLAAFEASKSLEASSLKPARPAPQPPTSGQSTGRAQSLPPIAQALKDHLAAYQQFKN
G
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcttaatggaattggtcaggccgtttctacactaggacggcagcttgcaaatgtggca
agtcgggtgggctctgtgggaggtgcgagcttttcagtttcccctcaggcagtgcgtctg
accacgattagaattcaatctcctttttctccggctgtgtcgcatatcaatgcaagaacg
aattttaatgtgagtggagttacaacgtcattaactccctctcgccctgcaccatcaccg
ccgacaagtggacagtccaccgggcgatcccagtctttaccccctattgcacaggcatta
aaagaccatttggcagcctttgaagcgtctaaaagtttagaggcctcaagccttaagcca
gctcgtccggcaccacaatcaccgacaaatggacagtccaccgggcgatcccagtcttta
ccccccattgcacaggcattaaaagaccatttggcagcttttgaagcgtctaaaagttta
gaggcctcaaaccttaagccagctcgtccggcaccacaaccaccgacaaatggacagtcc
accgggcgagcccagtctttaccccccattgcacaggcattaaaagaccatttggcagct
tttgaagcgtctaaaagtttagaggcctcaagccttaagccagctcgtccggcaccacaa
ccaccgacaagtggacagtccaccgggcgatctcagtctttaccccctattgcacaggca
ttaaaagaccatttggcagcctttgaagcgtctaaaagtttagaggcctcaagccttaag
ccagctcgtccggcaccacaaccaccgacaagtggacagtccaccggacgagcccagtct
ttacctcccattgcacaggcattaaaagatcatttggcagcctatcagcaatttaaaaat
ggataa

DBGET integrated database retrieval system