KEGG   Citrobacter rodentium: ROD_29851
Entry
ROD_29851         CDS       T01145                                 
Symbol
tir
Name
(GenBank) Tir, translocated intimin receptor
  KO
K12784  translocated intimin receptor
Organism
cro  Citrobacter rodentium
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
SSDB
Motif
Pfam: Tir_receptor_N Tir_receptor_C Tir_receptor_M CaM_bind DUF2490 DUF2155
Other DBs
NCBI-ProteinID: CBG89718
UniProt: D2TKE8
LinkDB
Position
complement(3159159..3160802)
AA seq 547 aa
MPIGNLGNNNISNNLIPPAPPLPSQTDGATRGNGSSLISSTGSLGSRLLFSPLRSSIVDT
VDSRDVPGLPEHPLRFATSETCLHGGFEVLHDKGPLDTLNQKIGSSVFRVEQQPDGTHAA
IGVKDGVEVSVTLNSSELQSLQSLDTEGNGRFVFTGGRGGSGHAMVTVASDISQAREKII
AKLDPDNHGGRQPKDIDTRSVGVGSASGMGDGVVSETHTSTTTSSVRSDPKFWVSVGAIA
AGLAGLAATGIVQAVALTPAPDDPTTTDPDEAANAAEAATKDQLTKEAFQNPDNQKVNID
ELGNAIPSGELKDDVVAQIADQAKVAGEQARQQAVESNAQAQQRHDDQQAKRQQELDLSS
GIGYGLSSALIVGGGIGAGVTAMLHRRNPPTEQTIATTHSVIQQQTGGNTRAQGGADTTG
VENASLTRRDSQASVASTQWSDTSGDVVNPYAEGWMSRNNPSLLAPEEPIYDEVAPDPNY
SVIQHFSGNNPVTGRLVGSPGQGIQSTYALLASSGGLRLGMGGLTGGGESAGSAANAATT
PGVERFV
NT seq 1644 nt   +upstreamnt  +downstreamnt
atgcctattggtaatcttggtaataataatataagtaacaatttaattccgcctgcgccg
ccactaccgtcacaaacagacggcgcgacaagggggaatggtagtagtcttattagctct
acaggatcattgggatctcgtttattattttctcccctgagaagttctatcgttgatact
gttgattccagagatgttccagggcttcctgaacatccattgcgttttgcgacatcagag
acatgtttgcatgggggatttgaggttcttcatgataagggaccacttgatactctaaat
cagaaaattggatcctctgtatttcgtgttgaacagcagccagatggtacccatgctgct
attggggtaaaagatggtgtagaggttagcgttacattaaattctagtgaattgcaaagc
ttgcaatctcttgacactgaaggtaacggtcgatttgttttcaccgggggacgtggtggt
agtgggcatgccatggtcactgttgcatcagatatctcgcaagctcgtgagaaaataata
gctaagttagatccagacaaccatggaggaagacaacctaaggacattgatacacgttct
gttggtgtcggaagtgcttcaggaatgggagatggagttgttagcgaaactcatacttca
acaacaacttcaagtgttcgttcagatcctaaattctgggtttctgttggcgcaattgct
gctggtttagcggggctggcagctacaggtattgttcaggcggttgctttgacaccagct
ccggatgatcctacaaccacagatcctgatgaagccgcaaatgctgcagaagctgcgaca
aaagatcagttaacgaaggaggcgttccagaatcctgataatcagaaagttaacattgat
gagctcggaaatgcaattccgtcgggtgagttaaaagatgatgttgttgcgcaaatagca
gatcaggctaaagtggcgggtgaacaggccagacagcaagctgttgaaagcaatgcacag
gcgcagcagcggcatgatgatcagcaggctaaacgtcagcaggaattggatctctcatca
ggtattggttacggcctcagtagtgcattgattgttggtggggggattggtgctggtgtt
acggctatgctccatagacgaaatccgccgacagaacagacaatagctactacacattcg
gttattcagcagcagaccgggggaaatactcgagcacaaggcggcgctgacaccactgga
gtggaaaacgcttctctgactagacgtgattcgcaggctagtgttgcatcgacccaatgg
tcagatacctctggcgatgtggtgaatccgtatgctgaaggttggatgtccaggaataat
ccatcgcttctcgctccagaagagcctatttatgatgaagtcgctccggatcctaactat
agcgttattcagcatttttcagggaataatcctgtgactgggcggttagtaggatctcct
gggcagggtatccaaagcacttatgcgcttctcgcaagcagcggtggattgcgattaggt
atgggaggattgactgggggaggtgagagcgcagggagcgctgcgaatgccgctacaaca
ccgggagttgaacgtttcgtctaa

DBGET integrated database retrieval system