KEGG   Citrobacter rodentium: ROD_29891
Entry
ROD_29891         CDS       T01145                                 
Symbol
espH
Name
(GenBank) T3SS effector protein EspH
  KO
K12788  LEE-encoded effector EspH
Organism
cro  Citrobacter rodentium
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
SSDB
Other DBs
NCBI-ProteinID: CBG89721
UniProt: D2TKF1
LinkDB
Position
complement(3162490..3163029)
AA seq 179 aa
MDYIGRCIMSSSLSGITFTTFLTNNHASWNRLTRNLYISNTDIVDEVQLKARTQQRHHRI
FPEIDDCSIIHFRGKEYFVRFIKDDKSNDYIYKVQKMTQESGCFSKIFGFLYGGVTKALE
CKLNERHITPLSSTWYPRSSLEGFLTERGLSSLLRRVQSTENVPLSESATLNPLSGMMV
NT seq 540 nt   +upstreamnt  +downstreamnt
atggattatatagggagatgtatcatgtcgtcatcattgtcaggtataacttttactact
tttttgacaaacaatcatgcatcatggaacaggttgaccagaaatctttatatatcgaat
actgatatagttgatgaagttcaacttaaagcacgtactcaacagcgtcaccatcggatt
tttccagagattgatgactgttcaattatccattttcgtggaaaagagtattttgttcgc
ttcattaaagatgataaaagtaatgattatatatacaaagtacaaaagatgactcaggaa
agtggatgtttctcaaagatatttggctttttgtatggcggtgttacgaaggccctggag
tgtaaattaaatgagagacatattactccactttcttcaacctggtatcctcgctcttca
ttagaaggcttcttaactgaaagagggctttcctctttgttacgtcgcgtacaatctacg
gaaaatgtccccctttctgagtcagccacattaaaccctttgtcaggcatgatggtttaa

DBGET integrated database retrieval system