KEGG   Citrobacter rodentium: ROD_29901
Entry
ROD_29901         CDS       T01145                                 
Symbol
sepQ
Name
(GenBank) T3SS structural protein SepQ
  KO
K03225  type III secretion protein Q
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_29901 (sepQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_29901 (sepQ)
Secretion system [BR:cro02044]
 Type III secretion system
  Type III secretion core apparatus
   ROD_29901 (sepQ)
SSDB
Motif
Pfam: SepQ
Other DBs
NCBI-ProteinID: CBG89722
UniProt: D2TKF2
LinkDB
Position
complement(3163035..3163952)
AA seq 305 aa
MKPLNSQSNMKINDFYLPLLPVIGIGRLYITSEGHACHAYFREVSGNGFRFTLAYSGYEG
CFWVSEEQLIQWCHELFPYSDSRLIPEDTIKLMLLWAIHATLPEDDASVDDVQFTTLNKD
IYPVIENNNGKNRLNVIILETTVQSLQYLINDNWQLVPHSNTLFFDGYIAPGWTDYPITK
LSIGDSLRLYHVDDSQERKCWLVINNPLATVKLSDNNLSVTDVQAADPLCIISNETVMNR
IYCAIGTINVDIHKLRNLKKDDTIGSVGYHLFGGGRLIRNNTIIAYGTIIKINEDFYFNI
SVVCD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgaagccattgaattctcaatcgaatatgaaaattaatgatttttacttaccattatta
cctgtcataggaatcggtcgcctctatattacgtccgaagggcatgcttgccatgcatat
tttcgtgaggtcagcggtaatggttttcgtttcacgttggcatactcgggctatgagggg
tgtttttgggtatcagaagagcagcttattcagtggtgccatgagttattcccgtatagc
gatagtagattgattcccgaagatacgataaaactcatgctcctatgggcaatacacgca
acattaccagaagatgatgcgtcagttgatgatgttcaatttacgacgttaaataaagat
atttatccggtaatagaaaataataatggtaaaaacagacttaatgtaattattcttgaa
acgacggtacaaagtttacaatatctgattaatgataattggcaattagttccgcattct
aatactcttttttttgatggttatatcgcacctggatggactgattatccaattacaaaa
ttgagtattggtgatagtttaagactctatcatgttgatgatagtcaagagagaaaatgt
tggcttgttattaataaccctttggcaaccgtaaagttaagtgataataatttgtctgtt
acggatgttcaggccgcggatccgttatgtattatcagcaacgagactgtaatgaatcgt
atttattgtgcgattggtacaataaatgtcgatatacataaattgcggaatttaaaaaaa
gatgatactataggttctgtcggatatcatcttttcggtggggggcggttaatacggaat
aatacaataatagcatatggaactattataaaaatcaatgaggatttttattttaatatt
agcgtagtatgtgattaa

DBGET integrated database retrieval system