KEGG   Citrobacter rodentium: ROD_30001
Entry
ROD_30001         CDS       T01145                                 
Symbol
escC
Name
(GenBank) T3SS structural protein EscC
  KO
K03219  type III secretion protein C
Organism
cro  Citrobacter rodentium
Pathway
cro03070  Bacterial secretion system
Module
cro_M00542  EHEC/EPEC pathogenicity signature, T3SS and effectors
Brite
KEGG Orthology (KO) [BR:cro00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ROD_30001 (escC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cro02044]
    ROD_30001 (escC)
Secretion system [BR:cro02044]
 Type III secretion system
  Type III secretion core apparatus
   ROD_30001 (escC)
SSDB
Motif
Pfam: Secretin Secretin_N DUF4974 ACOX
Other DBs
NCBI-ProteinID: CBG89732
UniProt: D2TKG2
LinkDB
Position
3170390..3171928
AA seq 512 aa
MKKISLFIFTALFFCNTQAAPSSLEKRLGESEYFIITKSSPVSVILNDFAANYSIPVFIS
NSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDS
LLKYLRDTISVNKSSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSKAKNKDVV
KVFKLNYASATDITYKYRDQNVVVPGVVSILKTMASNGSLPSTGKGAVERSGNLFDNSVN
ISADPRLNAVVVKDREITMDIYQQLISELDIEQRQIEISVSIIDVDANDLQQLGVNWSGT
LNAGQSSIAFNSSAAQANISSSVISNASNFMIRVNALQQNSKAKILSQPSIITLNNMQAI
LDKNVTFYTKVSGEKVASLESITSGTLLRVTPRILDDTSNSLTGKRRERVRLLLDIQDGN
QSVNQSNIQNAGSLLPEVQNSEMTTEATLSAGESLLLGGFIQDKESSSKDGIPLLSDIPV
IGSLFSSTVKQKHSVVRLFLIKATPIRSASSE
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgaaaaaaataagcctttttatttttacagcattatttttttgcaatactcaggcggcc
ccatcctctctggaaaaaagattaggcgagagcgagtattttattattacaaaaagttct
ccagtaagcgtgatccttaatgactttgccgctaactacagcattcctgttttcatcagt
aattctgtgaatgatgatttctctggcgaaataaaaaatgaaaaaccagtaaaagtattg
gagaaactgtccaaactttatcatctcacatggtattatgatgaaaacatcttgtatatt
tataaaacaaatgaaatatcaagaagcataattacaccaacatatctggatattgattca
ctgctaaaatatttgcgtgatacgatctctgtaaacaaaagttcctgtaatgtgagaaaa
atcacgacgtttaactctattgaagttcggggcgttccagaatgtataaaatatattaca
tctttatcggaaagccttgacaaagaagcacaatctaaagctaaaaataaagatgtcgtt
aaagtctttaaattaaactatgcttcagcgacagatataacatacaaataccgcgaccaa
aatgttgtcgtgcctggcgtcgtctctatcctaaagacaatggcaagtaatggttcactt
cccagtaccggtaaaggtgcggttgaaagaagtggtaatctgttcgataatagtgtaaat
atttctgctgatccacgtcttaatgctgttgttgttaaagaccgtgaaataaccatggat
atatatcagcaattaatttctgagcttgacattgaacaaaggcaaattgaaatttccgtt
tcaattattgatgttgatgcaaacgatcttcaacagctaggtgtaaactggtccggtaca
ttaaatgcagggcaaagttctattgcctttaatagctctgcagcacaggctaatattagt
tcctctgtgataagtaacgctagtaatttcatgattagagtgaatgcgttacagcagaac
tcgaaagccaaaatactctctcagccatcaattataaccttaaataatatgcaggcgatt
cttgataaaaacgtcacgttttatacaaaagtttctggtgaaaaggtggcatcgctggaa
agtataaccagtgggacattgctgagagtgacaccacgtatacttgatgacacctcgaat
agtcttaccgggaaacgtcgggaacgagttcgtttgttacttgatattcaggatggcaac
cagtcggttaaccaaagcaatattcagaatgccggcagcctcttacccgaagtccaaaat
tcagaaatgacaacagaagcaacattaagcgcaggagaaagtctgctacttggcgggttc
attcaggataaagaaagttcaagtaaagatggtataccgttgttaagcgatattcctgtt
attggtagcctgttctccagtacggtaaaacaaaagcatagtgttgttcgactcttttta
attaaagcgaccccgataagatctgcatctagcgaataa

DBGET integrated database retrieval system