KEGG   Citrobacter rodentium: ROD_37891Help
Entry
ROD_37891         CDS       T01145                                 

Gene name
ppc
Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
cro  Citrobacter rodentium
Pathway
cro00620  Pyruvate metabolism
cro00680  Methane metabolism
cro01100  Metabolic pathways
cro01120  Microbial metabolism in diverse environments
cro01200  Carbon metabolism
Module
cro_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:cro00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ROD_37891 (ppc)
  09102 Energy metabolism
   00680 Methane metabolism
    ROD_37891 (ppc)
Enzymes [BR:cro01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ROD_37891 (ppc)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: CBG90493
UniProt: D2TTJ4
LinkDB All DBs
Position
3990235..3992886
Genome map
AA seq 883 aa AA seqDB search
MNEQYSALRSNVSMLGKVLGETIKDALGENILDRVETIRKLSKSSRAGNEANRQELLTTL
QNLSNDELLPVARAFSQFLNLANTAEQYHSISPKGEAASNPEVIARTLRKLKNQPNLNEA
TIKKAVESLSLELVLTAHPTEITRRTLIHKMVEVNACLKQLDNKDIVDYERHQLMRRLRQ
LIAQSWHTDEIRKQRPSPVDEAKWGFAVVENSLWQGVPNYLRELNEQLEENLGYQLPVDF
VPVRFTSWMGGDRDGNPNVTADITRHVLLLSRWKATDLFLKDIQVLVSELSMVDATPELL
AMVGEEGASEPYRYLMKNLRSRLMATQAWLEARLKGEKLPKPAGLLTQNEQLWEPLYACY
QSLQACGMGIIANGELLDTLRRVKCFGVPLVRIDIRQESTRHTEALGELTRYLGIGDYES
WSEADKQAFLIRELNSKRPLLPRHWEPSNDTREVLDTCKVIAEAPKGSIAAYVISMAKTP
SDVLAVHLLLKEAGIGFAMPVAPLFETLDDLNNADDVMTQLLNIDWYRGLIQGKQMVMIG
YSDSAKDAGVMAASWAQYQAQDALIKTCEKAGIELTLFHGRGGSIGRGGAPAHAALLSQP
PGSLKGGLRVTEQGEMIRFKYGLPEVTVSSLSLYTSAILEANLLPPPEPKDAWRHIMDEL
SVISCDLYRGYVRENKDFVPYFRSATPEQELGKLPLGSRPAKRRPTGGVESLRAIPWIFA
WTQNRLMLPAWLGAGTALQKVVEDGKQSELEAMCRDWPFFSTRLGMLEMVFAKADLWLAE
YYDQRLVAKELWPLGKELRNLLAEDIKVVLDIANDSHLMADLPWIAESIQLRNIYTDPLN
VLQAELLHRSRLTEEQGKEPDPRVEQALMVTIAGVAAGMRNTG
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaacaatattccgcgttgcgtagtaatgtcagtatgctcggcaaagtgctggga
gaaaccatcaaggatgcgctgggagagaacattcttgatcgcgtagaaacaatccgtaag
ctgtcaaaatcttcacgcgctggcaatgaggcaaatcgccaggagttgctcaccacgtta
cagaatctgtcaaacgatgagctgctgccggtcgcacgcgcctttagccagtttctcaac
ctggccaacaccgcagagcagtatcacagcatttcgccgaagggcgaagccgccagcaac
ccggaagtgattgcccgcaccctgcgtaaactcaaaaaccagccgaatctcaacgaagcc
accatcaaaaaagcggtggaatctttgtcgctggagctggtgctgaccgcgcatccgaca
gaaatcacccgccgcacgctgatccacaaaatggtggaagtcaacgcctgcttaaaacag
ctcgataacaaagatatcgtcgattacgagcgccaccagctgatgcgccgtttgcgccag
ctgattgcccagtcatggcacacggatgaaattcgtaaacagcggccaagcccggtcgat
gaagccaagtggggcttcgcggtggtggagaacagcctgtggcagggcgtgccgaactat
ctgcgcgaactgaacgaacagctggaagagaatctcggctatcagttgccggttgatttt
gtccccgtgcgattcacgtcatggatgggcggcgaccgcgacggcaacccgaacgtcacc
gcggacattacccgccacgttctgctgctgagccgctggaaggccaccgatctgttcctg
aaagatattcaggtgctggtctcagagctgtcgatggtcgacgccacgccggagctgtta
gcgatggttggcgaagaaggcgccagtgagccgtaccgctatctgatgaaaaatctgcgt
tcccgcctgatggcgacccaggcgtggctggaagcgcgtctgaaaggcgaaaaactgccg
aagccggcgggactgctgacgcaaaacgaacagctgtgggagccgctgtacgcctgttac
cagtcgctgcaggcctgcggcatgggcattatcgccaacggcgaactgctcgacaccctg
cgtcgcgtgaaatgcttcggcgtaccgctggtgcgcattgatatccgtcaggaaagcacc
cgtcataccgaagcgctgggcgaactgacccgctacctcggcatcggcgattatgaaagc
tggtccgaagcggacaaacaggcgttcctgatccgcgagctgaactccaagcgtccgctg
ctgccacgtcactgggagccgagcaacgacacccgcgaagtgctcgatacctgtaaggtc
attgccgaagcgccgaaagggtcgattgccgcctacgtcatctcaatggcgaaaacgccg
tctgacgtcctggccgtccacctgctgttaaaagaggccggaattggcttcgcgatgccg
gttgccccgctgttcgaaacccttgacgacctgaataacgccgacgacgtcatgacccag
ctgctgaacatcgactggtatcgcggcctgattcagggcaagcagatggtgatgatcggc
tactccgactcggcgaaagacgccggggtgatggcggcgtcctgggcgcagtatcaggcg
caggatgcgttaatcaagacctgcgaaaaagcgggcattgaactgacgctgttccacggt
cgcggcggctccattggtcgcggcggcgcgcctgcccacgcggcgctgctctcccagccg
ccgggcagtctgaaaggcggcctgcgcgtcaccgagcagggcgagatgatccgctttaag
tacggcctgccggaagtgaccgtcagcagcctgtcgctttacaccagcgcgattctggag
gcgaacctgctgccgccgccggagccgaaggacgcctggcgtcatatcatggacgaactg
tcggttatctcctgcgatctgtaccgtggctacgttcgcgaaaataaagactttgtgccc
tatttccgttccgcaacgccggagcaggagctgggcaaactaccgctcggttcacgaccg
gcgaaacgtcgtccgaccggcggagtggaatcgctgcgcgccatcccgtggatcttcgcc
tggacgcaaaaccgactgatgctgccagcctggctgggcgcaggaaccgcgctgcaaaaa
gtggtcgaagacggcaagcagagcgaactggaagccatgtgccgcgactggccattcttc
tccacccgcctcgggatgctggaaatggtcttcgccaaagcggatttgtggctggcggaa
tattacgatcagcgtctggtcgccaaagagctgtggccgctgggcaaagaactgcgtaat
ctgctggcagaggacatcaaagtggtgctggatatcgccaacgactcgcatctgatggcc
gatctgccgtggattgccgaatctattcagttgcggaatatctacaccgacccgctgaac
gttctgcaggccgaactgctgcaccgctcacgcctgacggaagaacagggcaaagagccg
gacccgcgcgtggaacaggcgctgatggtcaccatcgccggcgttgccgcaggtatgcgt
aataccggctaa

DBGET integrated database retrieval system